Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421J871

Protein Details
Accession A0A421J871   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
78-97YLKYLTKRYLKKNQIRDWIRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPIVRQTNKKAKAAKKFVVDTSAPVENGVFDQEGYVKYLVEHIKVDNIVGNLGDDISVTEEGNKVVVVSNTKFSGKYLKYLTKRYLKKNQIRDWIRFVSVKQNQYQLQFYSVADEEEEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.74
3 0.71
4 0.69
5 0.64
6 0.6
7 0.52
8 0.43
9 0.38
10 0.34
11 0.26
12 0.22
13 0.2
14 0.15
15 0.14
16 0.13
17 0.09
18 0.06
19 0.07
20 0.08
21 0.08
22 0.1
23 0.1
24 0.08
25 0.08
26 0.14
27 0.14
28 0.14
29 0.15
30 0.13
31 0.15
32 0.15
33 0.15
34 0.12
35 0.11
36 0.1
37 0.08
38 0.08
39 0.06
40 0.06
41 0.05
42 0.03
43 0.03
44 0.04
45 0.05
46 0.04
47 0.05
48 0.05
49 0.05
50 0.06
51 0.05
52 0.04
53 0.05
54 0.06
55 0.08
56 0.09
57 0.11
58 0.12
59 0.13
60 0.13
61 0.13
62 0.2
63 0.18
64 0.23
65 0.26
66 0.34
67 0.38
68 0.44
69 0.51
70 0.52
71 0.58
72 0.63
73 0.68
74 0.7
75 0.74
76 0.78
77 0.79
78 0.8
79 0.79
80 0.75
81 0.71
82 0.64
83 0.58
84 0.5
85 0.42
86 0.43
87 0.44
88 0.44
89 0.4
90 0.44
91 0.44
92 0.46
93 0.49
94 0.39
95 0.35
96 0.32
97 0.28
98 0.26
99 0.23
100 0.2
101 0.17
102 0.16