Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JDJ9

Protein Details
Accession A0A421JDJ9   
Localization Confidence High
Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
60-87DEVRRLQKKAKLKQQRKLKKQQEEATRVHydrophilic
146-176ILAAQRQTNRKTKQKSKKDFNEKLKRGKISYHydrophilic
NLS Segment(s)
PositionSequence
63-93RRLQKKAKLKQQRKLKKQQEEATRVKKVAKH
155-172RKTKQKSKKDFNEKLKRG
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR031404  Rrt14  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF17075  RRT14  
Amino Acid Sequences MCNEGMSFSSQSSKLSAESTLQKFLSGIVPVEAVQAGKARSQSKAQAVNNQLKARALSADEVRRLQKKAKLKQQRKLKKQQEEATRVKKVAKHQIIKSHKENKELTVEEEKYLNKIVKRNANSLSRLSEIEDYELKSELESLQDEILAAQRQTNRKTKQKSKKDFNEKLKRGKISYPGLTPGLAPVGLDDDDEDSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.18
4 0.18
5 0.26
6 0.28
7 0.31
8 0.3
9 0.29
10 0.28
11 0.28
12 0.26
13 0.19
14 0.16
15 0.12
16 0.13
17 0.12
18 0.13
19 0.12
20 0.09
21 0.08
22 0.1
23 0.1
24 0.11
25 0.16
26 0.17
27 0.19
28 0.23
29 0.28
30 0.32
31 0.41
32 0.41
33 0.45
34 0.49
35 0.55
36 0.58
37 0.54
38 0.48
39 0.4
40 0.38
41 0.31
42 0.25
43 0.18
44 0.14
45 0.18
46 0.22
47 0.23
48 0.25
49 0.28
50 0.3
51 0.32
52 0.34
53 0.35
54 0.41
55 0.48
56 0.56
57 0.63
58 0.68
59 0.75
60 0.81
61 0.85
62 0.85
63 0.87
64 0.86
65 0.85
66 0.84
67 0.83
68 0.82
69 0.79
70 0.78
71 0.74
72 0.66
73 0.58
74 0.51
75 0.47
76 0.44
77 0.46
78 0.46
79 0.45
80 0.46
81 0.55
82 0.6
83 0.62
84 0.63
85 0.63
86 0.57
87 0.57
88 0.54
89 0.47
90 0.45
91 0.4
92 0.36
93 0.33
94 0.31
95 0.26
96 0.27
97 0.24
98 0.2
99 0.21
100 0.2
101 0.16
102 0.2
103 0.25
104 0.31
105 0.34
106 0.38
107 0.41
108 0.44
109 0.44
110 0.42
111 0.39
112 0.32
113 0.29
114 0.26
115 0.23
116 0.18
117 0.18
118 0.18
119 0.15
120 0.15
121 0.15
122 0.13
123 0.11
124 0.11
125 0.09
126 0.09
127 0.09
128 0.09
129 0.08
130 0.08
131 0.08
132 0.08
133 0.1
134 0.1
135 0.09
136 0.12
137 0.17
138 0.23
139 0.29
140 0.38
141 0.44
142 0.52
143 0.62
144 0.7
145 0.76
146 0.81
147 0.86
148 0.88
149 0.91
150 0.93
151 0.93
152 0.93
153 0.93
154 0.9
155 0.9
156 0.87
157 0.81
158 0.73
159 0.69
160 0.67
161 0.63
162 0.61
163 0.54
164 0.5
165 0.46
166 0.42
167 0.36
168 0.29
169 0.23
170 0.17
171 0.13
172 0.09
173 0.11
174 0.11
175 0.11
176 0.1