Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421J630

Protein Details
Accession A0A421J630    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
70-94LKEENFMKWRRKQINKTNTAKIKNNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLKLARQVQRTTHVARLHSSALAMQSSCKAGTVLNLKVRKSGDEPVALEDSEYPDWLWDCLDKQKMNESLKEENFMKWRRKQINKTNTAKIKNNNFMSTIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.41
4 0.35
5 0.3
6 0.26
7 0.2
8 0.17
9 0.16
10 0.14
11 0.11
12 0.11
13 0.12
14 0.12
15 0.11
16 0.09
17 0.08
18 0.13
19 0.17
20 0.21
21 0.27
22 0.3
23 0.3
24 0.33
25 0.34
26 0.31
27 0.29
28 0.29
29 0.24
30 0.24
31 0.24
32 0.23
33 0.24
34 0.21
35 0.18
36 0.14
37 0.13
38 0.1
39 0.1
40 0.07
41 0.06
42 0.07
43 0.07
44 0.07
45 0.05
46 0.07
47 0.12
48 0.17
49 0.18
50 0.19
51 0.25
52 0.33
53 0.34
54 0.37
55 0.37
56 0.39
57 0.39
58 0.43
59 0.37
60 0.33
61 0.39
62 0.42
63 0.45
64 0.44
65 0.53
66 0.59
67 0.68
68 0.75
69 0.78
70 0.82
71 0.85
72 0.85
73 0.85
74 0.84
75 0.81
76 0.79
77 0.77
78 0.76
79 0.76
80 0.74
81 0.66