Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JBV6

Protein Details
Accession A0A421JBV6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
3-32AASLPHPKIVKKHHKKFKRHQSDQFKRVAEBasic
NLS Segment(s)
PositionSequence
10-22KIVKKHHKKFKRH
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAASLPHPKIVKKHHKKFKRHQSDQFKRVAENWRKQKGIDSCVRRRFRGTIPQPNIGYGSNKKTRHMMPSGHKAYLVKNIKDLDVLLMHTKTYAAEIAHNVSAKNRVEIVAKAKKIGVKVTNPKGRVSLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.73
3 0.81
4 0.89
5 0.93
6 0.93
7 0.93
8 0.92
9 0.92
10 0.92
11 0.93
12 0.89
13 0.85
14 0.76
15 0.65
16 0.61
17 0.61
18 0.59
19 0.58
20 0.61
21 0.61
22 0.6
23 0.59
24 0.62
25 0.57
26 0.55
27 0.54
28 0.53
29 0.55
30 0.64
31 0.68
32 0.61
33 0.58
34 0.55
35 0.51
36 0.53
37 0.53
38 0.54
39 0.55
40 0.59
41 0.56
42 0.52
43 0.48
44 0.38
45 0.32
46 0.25
47 0.27
48 0.28
49 0.29
50 0.29
51 0.32
52 0.33
53 0.35
54 0.36
55 0.36
56 0.34
57 0.43
58 0.45
59 0.41
60 0.4
61 0.35
62 0.33
63 0.36
64 0.36
65 0.26
66 0.27
67 0.28
68 0.27
69 0.27
70 0.25
71 0.17
72 0.12
73 0.13
74 0.11
75 0.11
76 0.1
77 0.1
78 0.1
79 0.08
80 0.08
81 0.09
82 0.07
83 0.09
84 0.1
85 0.13
86 0.15
87 0.16
88 0.15
89 0.15
90 0.21
91 0.2
92 0.2
93 0.18
94 0.18
95 0.19
96 0.23
97 0.3
98 0.32
99 0.32
100 0.32
101 0.34
102 0.35
103 0.35
104 0.39
105 0.37
106 0.39
107 0.48
108 0.57
109 0.63
110 0.62
111 0.62
112 0.58