Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JA91

Protein Details
Accession A0A421JA91    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
177-199SEDRDKSRFRKILKNLKGKEKVPBasic
NLS Segment(s)
PositionSequence
185-196FRKILKNLKGKE
Subcellular Location(s) nucl 17, cyto 6, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000996  Clathrin_L-chain  
Gene Ontology GO:0030132  C:clathrin coat of coated pit  
GO:0030130  C:clathrin coat of trans-Golgi network vesicle  
GO:0005198  F:structural molecule activity  
GO:0006886  P:intracellular protein transport  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF01086  Clathrin_lg_ch  
Amino Acid Sequences MADKFPALDVGADVDENIDSDFLSREKELLGDEFKTENDKEALNSDDEFTEFNEQFPEVDQTEPAQHQQPEAYEEPAYEAPRDLGDSKALNDWKERRDLEIAEREKVNARTKEEIVKKAQQTIDDFYENYNTKREQSSQQVLKDEEQFLEKRDKFLSKGTLWDRVNELTTEVGETSSEDRDKSRFRKILKNLKGKEKVPGAGGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.08
5 0.06
6 0.05
7 0.06
8 0.08
9 0.07
10 0.1
11 0.1
12 0.1
13 0.11
14 0.12
15 0.13
16 0.14
17 0.17
18 0.15
19 0.17
20 0.17
21 0.17
22 0.21
23 0.19
24 0.19
25 0.17
26 0.17
27 0.16
28 0.18
29 0.19
30 0.17
31 0.17
32 0.15
33 0.14
34 0.14
35 0.13
36 0.12
37 0.16
38 0.14
39 0.14
40 0.14
41 0.14
42 0.13
43 0.14
44 0.16
45 0.11
46 0.12
47 0.12
48 0.12
49 0.15
50 0.15
51 0.16
52 0.17
53 0.16
54 0.16
55 0.17
56 0.17
57 0.19
58 0.19
59 0.19
60 0.15
61 0.14
62 0.17
63 0.18
64 0.18
65 0.13
66 0.12
67 0.1
68 0.1
69 0.12
70 0.1
71 0.09
72 0.1
73 0.1
74 0.11
75 0.15
76 0.16
77 0.15
78 0.19
79 0.22
80 0.22
81 0.27
82 0.26
83 0.25
84 0.25
85 0.26
86 0.26
87 0.31
88 0.31
89 0.27
90 0.26
91 0.25
92 0.26
93 0.29
94 0.32
95 0.26
96 0.28
97 0.3
98 0.31
99 0.39
100 0.4
101 0.4
102 0.37
103 0.41
104 0.38
105 0.4
106 0.4
107 0.34
108 0.32
109 0.31
110 0.3
111 0.24
112 0.23
113 0.19
114 0.23
115 0.22
116 0.2
117 0.2
118 0.18
119 0.19
120 0.21
121 0.24
122 0.23
123 0.3
124 0.39
125 0.41
126 0.44
127 0.45
128 0.44
129 0.44
130 0.42
131 0.35
132 0.27
133 0.25
134 0.22
135 0.21
136 0.29
137 0.27
138 0.26
139 0.28
140 0.3
141 0.29
142 0.33
143 0.38
144 0.29
145 0.37
146 0.38
147 0.43
148 0.41
149 0.41
150 0.39
151 0.34
152 0.34
153 0.26
154 0.24
155 0.16
156 0.16
157 0.15
158 0.12
159 0.1
160 0.08
161 0.09
162 0.1
163 0.14
164 0.15
165 0.14
166 0.16
167 0.22
168 0.31
169 0.35
170 0.43
171 0.45
172 0.5
173 0.59
174 0.68
175 0.74
176 0.75
177 0.81
178 0.78
179 0.82
180 0.85
181 0.76
182 0.75
183 0.7
184 0.62