Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421J7A6

Protein Details
Accession A0A421J7A6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
87-113EAYKECKRDFFNKKRQDKREGKKGWGABasic
NLS Segment(s)
PositionSequence
99-110KKRQDKREGKKG
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MEDPKAPPGANSDTVELDKSKVDFTSGGVDKFKFYPDNPENHRHKYRFAMKEPSKYYDPCEETRQASINCMIRNPEDKKTVCQDFFEAYKECKRDFFNKKRQDKREGKKGWGAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.25
4 0.2
5 0.17
6 0.16
7 0.15
8 0.13
9 0.14
10 0.12
11 0.13
12 0.2
13 0.2
14 0.21
15 0.22
16 0.22
17 0.22
18 0.23
19 0.24
20 0.17
21 0.16
22 0.25
23 0.27
24 0.35
25 0.38
26 0.47
27 0.51
28 0.56
29 0.64
30 0.55
31 0.53
32 0.54
33 0.58
34 0.56
35 0.55
36 0.58
37 0.54
38 0.61
39 0.61
40 0.57
41 0.5
42 0.43
43 0.41
44 0.38
45 0.37
46 0.31
47 0.33
48 0.31
49 0.29
50 0.3
51 0.31
52 0.24
53 0.22
54 0.24
55 0.23
56 0.21
57 0.21
58 0.21
59 0.19
60 0.26
61 0.29
62 0.29
63 0.33
64 0.33
65 0.37
66 0.42
67 0.47
68 0.4
69 0.38
70 0.35
71 0.31
72 0.31
73 0.31
74 0.26
75 0.24
76 0.29
77 0.3
78 0.29
79 0.3
80 0.33
81 0.4
82 0.49
83 0.56
84 0.61
85 0.68
86 0.78
87 0.85
88 0.88
89 0.89
90 0.89
91 0.88
92 0.88
93 0.84
94 0.81