Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421JC88

Protein Details
Accession A0A421JC88    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
73-100PDELQKRISKLPNKGKKKSTSAKRTLVVHydrophilic
NLS Segment(s)
PositionSequence
81-91SKLPNKGKKKS
Subcellular Location(s) nucl 15, mito_nucl 13.666, mito 11, cyto_nucl 8.666, cyto_mito 6.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR001884  IF5A-like  
IPR035503  IOC4-like_PWWP  
IPR012340  NA-bd_OB-fold  
IPR000313  PWWP_dom  
IPR014722  Rib_L2_dom2  
IPR035441  TFIIS/LEDGF_dom_sf  
IPR017923  TFIIS_N  
IPR019769  Trans_elong_IF5A_hypusine_site  
IPR020189  Transl_elong_IF5A_C  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0043022  F:ribosome binding  
GO:0003723  F:RNA binding  
GO:0003746  F:translation elongation factor activity  
GO:0003743  F:translation initiation factor activity  
GO:0045901  P:positive regulation of translational elongation  
GO:0045905  P:positive regulation of translational termination  
Pfam View protein in Pfam  
PF01287  eIF-5a  
PF08711  Med26  
PF00855  PWWP  
PROSITE View protein in PROSITE  
PS00302  IF5A_HYPUSINE  
PS50812  PWWP  
CDD cd05840  PWWP_ScIOC4-like  
cd04468  S1_eIF5A  
Amino Acid Sequences MPPKRARPLFKPRTLVLAKMQGFPAWPSFVMPEELIPENIMRVKKKSTEYCVIFIPDGDYYWVSEKSLEELTPDELQKRISKLPNKGKKKSTSAKRTLVVGDALIAAQGVDFDVFMKRLNANAGEEEDEEEEDEEEFEEENEEDDEDMGEDGDDDAEEVMHKDTDSVDKPTRKDRVNGRRNRGRSAPVEDEEVEVEDDEEEEEEEESMTYRRKRARSSTPLVATTRRRSANGSNGTSKQRSKPEPCTPKVLTEEERQHQLWLCRIKLQRSLIQRNQPITPTDTKAFPPPTVDELSIARLILHRLAEFPMNLDLLSTTKIHKVLKCILKDPDLEYPDSFKLHEKCNELLDKWSGLIDHLRQEKHKRGDARLNSQPPDDSEISGIESVKKEGESESETMGIPHVFETADAGAALTFPMQCSALRKNGHVVIKGRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPNVSRQEYQLLDIDDGFLSLMTQDGDTKDDVKIPEGELGDKIQSEFDEGKDLLVTIISAMGEEAAISYKEAPKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.61
3 0.56
4 0.55
5 0.49
6 0.46
7 0.45
8 0.36
9 0.35
10 0.33
11 0.3
12 0.22
13 0.2
14 0.18
15 0.19
16 0.2
17 0.21
18 0.19
19 0.16
20 0.17
21 0.19
22 0.18
23 0.17
24 0.16
25 0.16
26 0.2
27 0.24
28 0.24
29 0.26
30 0.32
31 0.38
32 0.47
33 0.53
34 0.56
35 0.61
36 0.62
37 0.61
38 0.58
39 0.54
40 0.45
41 0.37
42 0.31
43 0.22
44 0.18
45 0.18
46 0.14
47 0.13
48 0.16
49 0.16
50 0.14
51 0.16
52 0.15
53 0.16
54 0.18
55 0.17
56 0.15
57 0.16
58 0.19
59 0.22
60 0.23
61 0.21
62 0.2
63 0.23
64 0.26
65 0.29
66 0.33
67 0.38
68 0.45
69 0.54
70 0.63
71 0.71
72 0.77
73 0.81
74 0.82
75 0.82
76 0.84
77 0.84
78 0.84
79 0.84
80 0.84
81 0.82
82 0.76
83 0.71
84 0.62
85 0.54
86 0.44
87 0.33
88 0.24
89 0.17
90 0.14
91 0.1
92 0.08
93 0.05
94 0.04
95 0.04
96 0.03
97 0.03
98 0.03
99 0.04
100 0.06
101 0.06
102 0.07
103 0.1
104 0.1
105 0.11
106 0.14
107 0.15
108 0.16
109 0.17
110 0.18
111 0.18
112 0.18
113 0.18
114 0.16
115 0.14
116 0.13
117 0.11
118 0.1
119 0.08
120 0.08
121 0.07
122 0.06
123 0.06
124 0.06
125 0.07
126 0.06
127 0.07
128 0.07
129 0.07
130 0.07
131 0.07
132 0.07
133 0.06
134 0.06
135 0.05
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.05
146 0.05
147 0.06
148 0.06
149 0.06
150 0.07
151 0.12
152 0.14
153 0.19
154 0.26
155 0.3
156 0.33
157 0.4
158 0.46
159 0.44
160 0.49
161 0.54
162 0.58
163 0.64
164 0.71
165 0.73
166 0.75
167 0.76
168 0.74
169 0.68
170 0.63
171 0.57
172 0.55
173 0.51
174 0.42
175 0.42
176 0.37
177 0.34
178 0.28
179 0.24
180 0.16
181 0.11
182 0.09
183 0.06
184 0.06
185 0.05
186 0.05
187 0.04
188 0.04
189 0.05
190 0.04
191 0.05
192 0.04
193 0.05
194 0.06
195 0.11
196 0.13
197 0.18
198 0.24
199 0.29
200 0.35
201 0.42
202 0.52
203 0.56
204 0.61
205 0.64
206 0.6
207 0.6
208 0.56
209 0.53
210 0.49
211 0.44
212 0.44
213 0.38
214 0.35
215 0.36
216 0.39
217 0.42
218 0.44
219 0.43
220 0.4
221 0.43
222 0.46
223 0.46
224 0.44
225 0.4
226 0.4
227 0.44
228 0.46
229 0.52
230 0.58
231 0.63
232 0.63
233 0.65
234 0.59
235 0.55
236 0.53
237 0.47
238 0.4
239 0.38
240 0.42
241 0.35
242 0.38
243 0.34
244 0.31
245 0.3
246 0.28
247 0.27
248 0.25
249 0.24
250 0.27
251 0.29
252 0.31
253 0.34
254 0.36
255 0.36
256 0.4
257 0.48
258 0.47
259 0.53
260 0.53
261 0.49
262 0.47
263 0.43
264 0.36
265 0.31
266 0.28
267 0.24
268 0.22
269 0.21
270 0.21
271 0.25
272 0.25
273 0.21
274 0.2
275 0.19
276 0.21
277 0.21
278 0.2
279 0.16
280 0.15
281 0.16
282 0.14
283 0.12
284 0.09
285 0.08
286 0.09
287 0.09
288 0.09
289 0.07
290 0.08
291 0.09
292 0.1
293 0.09
294 0.09
295 0.09
296 0.08
297 0.08
298 0.07
299 0.07
300 0.06
301 0.08
302 0.07
303 0.08
304 0.1
305 0.13
306 0.16
307 0.18
308 0.22
309 0.29
310 0.34
311 0.36
312 0.37
313 0.37
314 0.37
315 0.37
316 0.35
317 0.34
318 0.29
319 0.28
320 0.24
321 0.25
322 0.23
323 0.22
324 0.21
325 0.19
326 0.2
327 0.24
328 0.29
329 0.29
330 0.3
331 0.34
332 0.36
333 0.31
334 0.31
335 0.28
336 0.23
337 0.19
338 0.18
339 0.13
340 0.11
341 0.13
342 0.12
343 0.16
344 0.21
345 0.22
346 0.27
347 0.34
348 0.42
349 0.45
350 0.5
351 0.49
352 0.5
353 0.59
354 0.61
355 0.62
356 0.62
357 0.62
358 0.57
359 0.53
360 0.48
361 0.39
362 0.38
363 0.31
364 0.23
365 0.18
366 0.17
367 0.17
368 0.17
369 0.16
370 0.12
371 0.11
372 0.12
373 0.12
374 0.11
375 0.11
376 0.1
377 0.13
378 0.14
379 0.15
380 0.15
381 0.15
382 0.15
383 0.14
384 0.15
385 0.12
386 0.09
387 0.08
388 0.07
389 0.06
390 0.06
391 0.07
392 0.07
393 0.07
394 0.06
395 0.06
396 0.05
397 0.05
398 0.06
399 0.04
400 0.04
401 0.04
402 0.05
403 0.06
404 0.07
405 0.12
406 0.16
407 0.23
408 0.25
409 0.26
410 0.31
411 0.36
412 0.4
413 0.4
414 0.39
415 0.4
416 0.48
417 0.53
418 0.5
419 0.47
420 0.44
421 0.43
422 0.44
423 0.4
424 0.36
425 0.37
426 0.39
427 0.44
428 0.44
429 0.4
430 0.41
431 0.39
432 0.39
433 0.42
434 0.43
435 0.42
436 0.48
437 0.52
438 0.5
439 0.5
440 0.44
441 0.36
442 0.31
443 0.25
444 0.19
445 0.15
446 0.14
447 0.1
448 0.1
449 0.08
450 0.1
451 0.11
452 0.12
453 0.16
454 0.19
455 0.23
456 0.27
457 0.31
458 0.31
459 0.3
460 0.3
461 0.26
462 0.26
463 0.25
464 0.24
465 0.27
466 0.27
467 0.28
468 0.28
469 0.28
470 0.29
471 0.26
472 0.26
473 0.23
474 0.23
475 0.22
476 0.2
477 0.21
478 0.16
479 0.15
480 0.12
481 0.08
482 0.06
483 0.05
484 0.06
485 0.05
486 0.06
487 0.07
488 0.08
489 0.11
490 0.12
491 0.14
492 0.14
493 0.18
494 0.18
495 0.2
496 0.21
497 0.2
498 0.24
499 0.23
500 0.24
501 0.21
502 0.22
503 0.21
504 0.19
505 0.18
506 0.15
507 0.14
508 0.17
509 0.17
510 0.16
511 0.2
512 0.2
513 0.2
514 0.19
515 0.19
516 0.14
517 0.13
518 0.12
519 0.06
520 0.07
521 0.06
522 0.06
523 0.06
524 0.06
525 0.05
526 0.05
527 0.05
528 0.06
529 0.07
530 0.08
531 0.11