Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JE44

Protein Details
Accession A0A421JE44    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
175-198VQNWRDYVHKVDKKTKKKKKKVLABasic
NLS Segment(s)
PositionSequence
186-197DKKTKKKKKKVL
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
CDD cd06257  DnaJ  
Amino Acid Sequences MEDLDRELSAQEAALARDQEIARVLACASGDHFAVLDIWPGQDGKRAYRRKTILIHPDKTDNPRAPEAFDRLKKAEKVVNSIKENDEEMYLERERLESIYKHVGFDESNPESMSATTRDEAAKVLKREKAKLETDQSIERYQQEQEKKRVMELQKQRLAKKKQDSVWEDQRDTRVQNWRDYVHKVDKKTKKKKKKVLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.19
5 0.19
6 0.18
7 0.18
8 0.18
9 0.15
10 0.15
11 0.14
12 0.1
13 0.1
14 0.09
15 0.09
16 0.09
17 0.09
18 0.09
19 0.09
20 0.07
21 0.08
22 0.08
23 0.08
24 0.07
25 0.07
26 0.08
27 0.08
28 0.08
29 0.13
30 0.14
31 0.2
32 0.3
33 0.37
34 0.41
35 0.5
36 0.53
37 0.54
38 0.59
39 0.6
40 0.62
41 0.63
42 0.63
43 0.56
44 0.58
45 0.55
46 0.54
47 0.54
48 0.47
49 0.42
50 0.43
51 0.41
52 0.38
53 0.38
54 0.38
55 0.38
56 0.37
57 0.37
58 0.35
59 0.38
60 0.36
61 0.36
62 0.34
63 0.27
64 0.32
65 0.34
66 0.39
67 0.36
68 0.38
69 0.36
70 0.33
71 0.32
72 0.26
73 0.19
74 0.13
75 0.11
76 0.13
77 0.12
78 0.11
79 0.11
80 0.1
81 0.1
82 0.1
83 0.11
84 0.08
85 0.11
86 0.18
87 0.18
88 0.18
89 0.18
90 0.18
91 0.16
92 0.17
93 0.2
94 0.14
95 0.14
96 0.14
97 0.14
98 0.14
99 0.14
100 0.14
101 0.09
102 0.09
103 0.09
104 0.1
105 0.1
106 0.1
107 0.11
108 0.15
109 0.19
110 0.2
111 0.25
112 0.28
113 0.31
114 0.34
115 0.39
116 0.4
117 0.39
118 0.43
119 0.44
120 0.43
121 0.43
122 0.43
123 0.4
124 0.36
125 0.33
126 0.29
127 0.25
128 0.23
129 0.28
130 0.33
131 0.38
132 0.43
133 0.49
134 0.48
135 0.48
136 0.54
137 0.51
138 0.52
139 0.55
140 0.58
141 0.58
142 0.63
143 0.66
144 0.68
145 0.71
146 0.7
147 0.7
148 0.68
149 0.67
150 0.71
151 0.72
152 0.71
153 0.74
154 0.72
155 0.65
156 0.6
157 0.59
158 0.52
159 0.49
160 0.46
161 0.46
162 0.42
163 0.46
164 0.48
165 0.47
166 0.48
167 0.51
168 0.52
169 0.53
170 0.56
171 0.56
172 0.62
173 0.68
174 0.75
175 0.81
176 0.85
177 0.85
178 0.9