Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421J434

Protein Details
Accession A0A421J434    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
87-106KPGDKPKPPVRGPPPKRARHBasic
NLS Segment(s)
PositionSequence
89-106GDKPKPPVRGPPPKRARH
Subcellular Location(s) nucl 14.5, cyto_nucl 13.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
IPR034099  SmD3  
Gene Ontology GO:0005829  C:cytosol  
GO:0120114  C:Sm-like protein family complex  
GO:0005681  C:spliceosomal complex  
GO:0000387  P:spliceosomal snRNP assembly  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01721  Sm_D3  
Amino Acid Sequences MSAGIPVKLLNEAQGHVVSLELVTGDTYRGKLLENEDNMNLSLYDVVVTKGRTGATTHMNQVFVRGSMIRYISVPEILRNAPMFFMKPGDKPKPPVRGPPPKRARH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.13
4 0.13
5 0.09
6 0.07
7 0.07
8 0.04
9 0.04
10 0.04
11 0.04
12 0.05
13 0.06
14 0.07
15 0.07
16 0.08
17 0.08
18 0.1
19 0.15
20 0.2
21 0.22
22 0.23
23 0.23
24 0.24
25 0.23
26 0.21
27 0.17
28 0.1
29 0.08
30 0.05
31 0.05
32 0.05
33 0.05
34 0.07
35 0.07
36 0.07
37 0.08
38 0.08
39 0.08
40 0.09
41 0.11
42 0.14
43 0.15
44 0.18
45 0.19
46 0.2
47 0.19
48 0.2
49 0.17
50 0.13
51 0.13
52 0.1
53 0.09
54 0.1
55 0.11
56 0.1
57 0.09
58 0.11
59 0.11
60 0.13
61 0.13
62 0.12
63 0.14
64 0.14
65 0.16
66 0.16
67 0.15
68 0.13
69 0.14
70 0.15
71 0.13
72 0.17
73 0.17
74 0.22
75 0.3
76 0.37
77 0.41
78 0.47
79 0.54
80 0.6
81 0.62
82 0.67
83 0.69
84 0.73
85 0.75
86 0.79