Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JFR8

Protein Details
Accession A0A421JFR8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-52ASPILHLRPSKRKSKKKPSVRWTEDTVHydrophilic
NLS Segment(s)
PositionSequence
33-43RPSKRKSKKKP
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MAQQASSQTRSQGTSSTTQTTTQTSASPILHLRPSKRKSKKKPSVRWTEDTVDNEHMNKKKTKICCIFHPQRQFDDGSSCDSCGSSSDSSSDSSDGSDTEASKPNAYEHQPNYKNQSKLPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.31
4 0.3
5 0.3
6 0.3
7 0.3
8 0.28
9 0.23
10 0.2
11 0.18
12 0.2
13 0.19
14 0.19
15 0.18
16 0.19
17 0.24
18 0.26
19 0.31
20 0.37
21 0.42
22 0.51
23 0.6
24 0.68
25 0.74
26 0.82
27 0.86
28 0.87
29 0.92
30 0.92
31 0.92
32 0.89
33 0.82
34 0.76
35 0.69
36 0.62
37 0.54
38 0.46
39 0.38
40 0.31
41 0.28
42 0.27
43 0.26
44 0.25
45 0.26
46 0.27
47 0.29
48 0.33
49 0.41
50 0.45
51 0.45
52 0.5
53 0.57
54 0.61
55 0.63
56 0.68
57 0.61
58 0.54
59 0.53
60 0.46
61 0.37
62 0.33
63 0.26
64 0.23
65 0.21
66 0.19
67 0.17
68 0.16
69 0.15
70 0.13
71 0.15
72 0.11
73 0.11
74 0.12
75 0.13
76 0.14
77 0.15
78 0.15
79 0.11
80 0.11
81 0.11
82 0.09
83 0.1
84 0.1
85 0.11
86 0.14
87 0.2
88 0.21
89 0.22
90 0.23
91 0.23
92 0.28
93 0.31
94 0.36
95 0.35
96 0.45
97 0.48
98 0.53
99 0.59
100 0.61
101 0.6