Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421J7B9

Protein Details
Accession A0A421J7B9   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
163-188KQEPSQFKPPSKIRRRFVRIPPRSSTHydrophilic
NLS Segment(s)
PositionSequence
148-161RKVGISRPSSKRTT
163-163K
166-179PSQFKPPSKIRRRF
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018838  DUF2439  
Pfam View protein in Pfam  
PF10382  DUF2439  
Amino Acid Sequences MDPYKNSIVHEYRVLYSTRIVQKDKKWCDGILRYYEVNNKVELSHPTQLLLVSDFLNGSVGFVMNEILASGHEFKLPNKSFLVMVDEKIGSSARDVSQAIRARNDTVVVPQPFVKSEPSVKIEPSVERLVASSRLVTDNKPIRPLAGRKVGISRPSSKRTTVKQEPSQFKPPSKIRRRFVRIPPRSSTVFQYLNLGCYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.26
3 0.24
4 0.3
5 0.33
6 0.36
7 0.39
8 0.43
9 0.51
10 0.6
11 0.65
12 0.64
13 0.59
14 0.55
15 0.59
16 0.6
17 0.58
18 0.53
19 0.5
20 0.44
21 0.43
22 0.48
23 0.43
24 0.37
25 0.31
26 0.26
27 0.23
28 0.25
29 0.26
30 0.25
31 0.25
32 0.24
33 0.24
34 0.23
35 0.23
36 0.21
37 0.18
38 0.13
39 0.09
40 0.09
41 0.08
42 0.08
43 0.08
44 0.07
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.07
58 0.07
59 0.09
60 0.1
61 0.11
62 0.21
63 0.22
64 0.23
65 0.21
66 0.22
67 0.2
68 0.2
69 0.26
70 0.16
71 0.16
72 0.16
73 0.15
74 0.14
75 0.14
76 0.14
77 0.07
78 0.07
79 0.09
80 0.07
81 0.09
82 0.1
83 0.1
84 0.17
85 0.21
86 0.21
87 0.2
88 0.21
89 0.2
90 0.2
91 0.2
92 0.13
93 0.12
94 0.18
95 0.16
96 0.16
97 0.17
98 0.17
99 0.17
100 0.18
101 0.17
102 0.12
103 0.15
104 0.18
105 0.21
106 0.21
107 0.21
108 0.22
109 0.22
110 0.21
111 0.23
112 0.2
113 0.16
114 0.15
115 0.16
116 0.15
117 0.15
118 0.14
119 0.1
120 0.1
121 0.13
122 0.14
123 0.14
124 0.22
125 0.27
126 0.28
127 0.31
128 0.3
129 0.29
130 0.34
131 0.38
132 0.37
133 0.39
134 0.38
135 0.37
136 0.43
137 0.45
138 0.44
139 0.44
140 0.45
141 0.43
142 0.48
143 0.5
144 0.5
145 0.53
146 0.55
147 0.61
148 0.63
149 0.65
150 0.69
151 0.76
152 0.77
153 0.77
154 0.79
155 0.74
156 0.69
157 0.68
158 0.68
159 0.69
160 0.73
161 0.76
162 0.75
163 0.8
164 0.85
165 0.85
166 0.87
167 0.87
168 0.85
169 0.83
170 0.8
171 0.74
172 0.7
173 0.63
174 0.58
175 0.55
176 0.48
177 0.41
178 0.43
179 0.38