Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JDJ5

Protein Details
Accession A0A421JDJ5   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
99-128PPEAAERGRRQRRKQNRKQRPLKQQQLSQAHydrophilic
NLS Segment(s)
PositionSequence
104-119ERGRRQRRKQNRKQRP
Subcellular Location(s) nucl 14, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006594  LisH  
Gene Ontology GO:0031326  P:regulation of cellular biosynthetic process  
PROSITE View protein in PROSITE  
PS50896  LISH  
Amino Acid Sequences MTGVNDFYAQDSRQLLLAHLYTYMVENNLSDSAAQLFNESPVPRDPHFHECTSSLPPSNTSEQVLWDWWQLLWSLMPQSAPQAHPVYDHLVKISQVPIPPEAAERGRRQRRKQNRKQRPLKQQQLSQANLYQQYEIERARFIQEREASQLRKAHKLQQSEPPYGFMDDWLENMGSGPSLPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.18
4 0.18
5 0.15
6 0.14
7 0.14
8 0.11
9 0.12
10 0.12
11 0.09
12 0.09
13 0.08
14 0.1
15 0.1
16 0.1
17 0.08
18 0.08
19 0.1
20 0.11
21 0.1
22 0.1
23 0.1
24 0.11
25 0.15
26 0.14
27 0.14
28 0.17
29 0.22
30 0.21
31 0.26
32 0.3
33 0.34
34 0.38
35 0.37
36 0.35
37 0.32
38 0.34
39 0.34
40 0.32
41 0.25
42 0.21
43 0.22
44 0.24
45 0.26
46 0.24
47 0.21
48 0.19
49 0.19
50 0.19
51 0.18
52 0.15
53 0.13
54 0.12
55 0.1
56 0.1
57 0.08
58 0.08
59 0.07
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.08
66 0.1
67 0.11
68 0.13
69 0.14
70 0.13
71 0.14
72 0.15
73 0.17
74 0.16
75 0.16
76 0.13
77 0.12
78 0.12
79 0.13
80 0.13
81 0.1
82 0.1
83 0.11
84 0.11
85 0.11
86 0.11
87 0.11
88 0.12
89 0.13
90 0.17
91 0.21
92 0.31
93 0.4
94 0.48
95 0.55
96 0.64
97 0.72
98 0.8
99 0.85
100 0.87
101 0.88
102 0.91
103 0.94
104 0.93
105 0.93
106 0.93
107 0.92
108 0.88
109 0.82
110 0.8
111 0.76
112 0.69
113 0.6
114 0.51
115 0.44
116 0.39
117 0.35
118 0.26
119 0.19
120 0.19
121 0.2
122 0.18
123 0.17
124 0.15
125 0.15
126 0.19
127 0.22
128 0.2
129 0.26
130 0.28
131 0.29
132 0.35
133 0.41
134 0.38
135 0.39
136 0.43
137 0.39
138 0.44
139 0.44
140 0.47
141 0.47
142 0.53
143 0.52
144 0.58
145 0.61
146 0.58
147 0.56
148 0.5
149 0.46
150 0.4
151 0.35
152 0.26
153 0.24
154 0.18
155 0.18
156 0.17
157 0.15
158 0.13
159 0.13
160 0.12
161 0.08