Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421J9R5

Protein Details
Accession A0A421J9R5   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-73MDSVLRKRRLKMKKHKLRKRRRAQRSLKKRLGKLBasic
NLS Segment(s)
PositionSequence
45-73RKRRLKMKKHKLRKRRRAQRSLKKRLGKL
Subcellular Location(s) nucl 15, mito_nucl 12.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MPAFRQVQPVSKIASSSTNSIVNEIDTGVWNEPEDNTMYMDSVLRKRRLKMKKHKLRKRRRAQRSLKKRLGKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.25
3 0.24
4 0.24
5 0.24
6 0.24
7 0.24
8 0.23
9 0.17
10 0.16
11 0.13
12 0.1
13 0.07
14 0.09
15 0.08
16 0.08
17 0.08
18 0.07
19 0.07
20 0.08
21 0.08
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.08
28 0.1
29 0.14
30 0.2
31 0.26
32 0.29
33 0.33
34 0.43
35 0.52
36 0.6
37 0.66
38 0.71
39 0.76
40 0.84
41 0.91
42 0.92
43 0.94
44 0.95
45 0.95
46 0.95
47 0.95
48 0.94
49 0.95
50 0.96
51 0.96
52 0.96
53 0.94