Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A421JFC4

Protein Details
Accession A0A421JFC4   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
6-31NSRFHREGREKPQPKTKPRPKDSEFIBasic
NLS Segment(s)
PositionSequence
13-25GREKPQPKTKPRP
Subcellular Location(s) nucl 15, mito 5, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSKFDNSRFHREGREKPQPKTKPRPKDSEFISELVQTGKANWKKAPTAVRNRYYGIYMILFSIPILILPSYEIWRRLEGKSTKQVQKGEILEGQQVRPFDEREKWEKEKNSLMYRIFGRDFFLDGFTSKTMRGKEDEKNEKNDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.69
3 0.73
4 0.79
5 0.79
6 0.82
7 0.83
8 0.84
9 0.83
10 0.84
11 0.87
12 0.81
13 0.79
14 0.74
15 0.72
16 0.64
17 0.54
18 0.47
19 0.38
20 0.34
21 0.26
22 0.22
23 0.13
24 0.12
25 0.19
26 0.22
27 0.24
28 0.26
29 0.28
30 0.29
31 0.35
32 0.42
33 0.42
34 0.5
35 0.56
36 0.58
37 0.57
38 0.57
39 0.52
40 0.44
41 0.36
42 0.26
43 0.18
44 0.13
45 0.12
46 0.1
47 0.09
48 0.07
49 0.07
50 0.05
51 0.04
52 0.04
53 0.03
54 0.03
55 0.04
56 0.05
57 0.07
58 0.08
59 0.1
60 0.1
61 0.12
62 0.15
63 0.15
64 0.23
65 0.24
66 0.29
67 0.36
68 0.43
69 0.46
70 0.49
71 0.5
72 0.44
73 0.46
74 0.42
75 0.36
76 0.3
77 0.25
78 0.24
79 0.23
80 0.22
81 0.18
82 0.17
83 0.16
84 0.16
85 0.17
86 0.17
87 0.22
88 0.27
89 0.31
90 0.39
91 0.42
92 0.48
93 0.51
94 0.52
95 0.54
96 0.56
97 0.56
98 0.54
99 0.5
100 0.47
101 0.45
102 0.45
103 0.38
104 0.31
105 0.28
106 0.23
107 0.23
108 0.2
109 0.19
110 0.15
111 0.15
112 0.17
113 0.15
114 0.15
115 0.15
116 0.19
117 0.19
118 0.22
119 0.26
120 0.3
121 0.37
122 0.47
123 0.57
124 0.58