Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A421J3Z9

Protein Details
Accession A0A421J3Z9    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
155-175NYVSARVRAKRQKEMQTPGFFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 11.333, mito_nucl 9.166, cyto 9, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSVPFPNDYTLRRVAESDSKACTICFKPTSCVLLSANKVDFFHACEAHLGDSTFCTPEYPESYKELNAKKLELENKIRGLAKQIEQAQPYAWTKFMSGWKKPPSEDKQEPDKLAKLEDEKKALTTELESVASQLKQTKVKDYKLDNGIYKSRIQNYVSARVRAKRQKEMQTPGFFPAAPTGKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.4
4 0.37
5 0.35
6 0.34
7 0.33
8 0.32
9 0.33
10 0.27
11 0.29
12 0.31
13 0.29
14 0.31
15 0.35
16 0.39
17 0.34
18 0.35
19 0.3
20 0.32
21 0.32
22 0.32
23 0.3
24 0.27
25 0.27
26 0.25
27 0.23
28 0.2
29 0.21
30 0.17
31 0.16
32 0.16
33 0.16
34 0.16
35 0.16
36 0.13
37 0.1
38 0.1
39 0.11
40 0.1
41 0.09
42 0.09
43 0.08
44 0.11
45 0.16
46 0.18
47 0.19
48 0.22
49 0.24
50 0.26
51 0.32
52 0.33
53 0.34
54 0.32
55 0.31
56 0.28
57 0.32
58 0.34
59 0.33
60 0.36
61 0.33
62 0.33
63 0.35
64 0.34
65 0.29
66 0.29
67 0.27
68 0.22
69 0.24
70 0.27
71 0.27
72 0.27
73 0.27
74 0.23
75 0.23
76 0.22
77 0.18
78 0.14
79 0.11
80 0.11
81 0.14
82 0.21
83 0.23
84 0.25
85 0.32
86 0.38
87 0.39
88 0.4
89 0.46
90 0.45
91 0.49
92 0.52
93 0.5
94 0.53
95 0.55
96 0.56
97 0.49
98 0.47
99 0.37
100 0.32
101 0.29
102 0.26
103 0.28
104 0.29
105 0.29
106 0.26
107 0.27
108 0.26
109 0.24
110 0.19
111 0.14
112 0.13
113 0.12
114 0.12
115 0.11
116 0.11
117 0.13
118 0.13
119 0.13
120 0.15
121 0.17
122 0.22
123 0.23
124 0.33
125 0.37
126 0.43
127 0.49
128 0.5
129 0.54
130 0.55
131 0.58
132 0.52
133 0.5
134 0.5
135 0.44
136 0.44
137 0.41
138 0.4
139 0.4
140 0.38
141 0.39
142 0.4
143 0.49
144 0.48
145 0.49
146 0.49
147 0.49
148 0.58
149 0.61
150 0.62
151 0.62
152 0.67
153 0.72
154 0.76
155 0.81
156 0.8
157 0.78
158 0.73
159 0.66
160 0.58
161 0.48
162 0.39
163 0.38