Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420I818

Protein Details
Accession A0A420I818    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
129-152IPLCRRCHMERHTLNKKPKIKVTKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, mito_nucl 13.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024937  Domain_X  
IPR003615  HNH_nuc  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043231  C:intracellular membrane-bounded organelle  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF01348  Intron_maturas2  
CDD cd00085  HNHc  
Amino Acid Sequences MRGFDNYYSFASNHGQLAGYLTLILKRSCSKLLAAKFKLRSMKATYLKFSGANFVKLSNKSTGEFRIKASPVMTGLYALKSLATLYDMRCIVCDSEEYIEMHHIRMMKDANPKLSKVDEIMVKANRKQIPLCRRCHMERHTLNKKPKIKVTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.14
4 0.17
5 0.15
6 0.11
7 0.1
8 0.09
9 0.11
10 0.13
11 0.13
12 0.12
13 0.15
14 0.18
15 0.2
16 0.21
17 0.23
18 0.28
19 0.36
20 0.44
21 0.46
22 0.5
23 0.51
24 0.55
25 0.58
26 0.51
27 0.48
28 0.45
29 0.5
30 0.49
31 0.5
32 0.47
33 0.42
34 0.43
35 0.39
36 0.32
37 0.31
38 0.25
39 0.23
40 0.21
41 0.21
42 0.24
43 0.24
44 0.26
45 0.22
46 0.22
47 0.2
48 0.22
49 0.26
50 0.27
51 0.27
52 0.26
53 0.28
54 0.27
55 0.27
56 0.26
57 0.21
58 0.16
59 0.15
60 0.13
61 0.08
62 0.08
63 0.07
64 0.07
65 0.06
66 0.05
67 0.05
68 0.05
69 0.04
70 0.05
71 0.06
72 0.06
73 0.11
74 0.11
75 0.11
76 0.11
77 0.12
78 0.11
79 0.1
80 0.1
81 0.08
82 0.09
83 0.1
84 0.1
85 0.1
86 0.13
87 0.13
88 0.13
89 0.13
90 0.13
91 0.12
92 0.15
93 0.17
94 0.18
95 0.27
96 0.29
97 0.36
98 0.36
99 0.37
100 0.36
101 0.36
102 0.33
103 0.25
104 0.27
105 0.21
106 0.22
107 0.27
108 0.3
109 0.32
110 0.34
111 0.4
112 0.39
113 0.39
114 0.42
115 0.45
116 0.51
117 0.56
118 0.6
119 0.59
120 0.63
121 0.65
122 0.7
123 0.66
124 0.66
125 0.66
126 0.7
127 0.74
128 0.76
129 0.81
130 0.81
131 0.84
132 0.81