Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HAP5

Protein Details
Accession A0A420HAP5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-34QREPSDHIRQRIKKIKKKNKNGKSTPGIMHydrophilic
NLS Segment(s)
PositionSequence
14-28RQRIKKIKKKNKNGK
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MVLPLQREPSDHIRQRIKKIKKKNKNGKSTPGIMYRSLRVPKFDFDPEIHFAPSFVAKFNGPRERRTRRLICLYLSLLPTPSPN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.71
3 0.76
4 0.78
5 0.77
6 0.82
7 0.86
8 0.86
9 0.91
10 0.92
11 0.91
12 0.92
13 0.89
14 0.87
15 0.82
16 0.76
17 0.7
18 0.65
19 0.57
20 0.48
21 0.43
22 0.35
23 0.35
24 0.34
25 0.3
26 0.27
27 0.26
28 0.25
29 0.27
30 0.26
31 0.23
32 0.2
33 0.23
34 0.23
35 0.23
36 0.21
37 0.18
38 0.16
39 0.15
40 0.16
41 0.12
42 0.1
43 0.1
44 0.1
45 0.14
46 0.22
47 0.31
48 0.3
49 0.37
50 0.46
51 0.54
52 0.6
53 0.66
54 0.66
55 0.64
56 0.72
57 0.69
58 0.62
59 0.59
60 0.55
61 0.49
62 0.44
63 0.37
64 0.28