Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420I1Q0

Protein Details
Accession A0A420I1Q0    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
62-87NITQRGKGKNKQRKNKWRSNNSTTKSHydrophilic
NLS Segment(s)
PositionSequence
66-78RGKGKNKQRKNKW
Subcellular Location(s) nucl 16, mito 11
Family & Domain DBs
Amino Acid Sequences MKRTPPQIRESAIGIPPLSQLQKHATQSNSPLQYTSSHHSQCNSISEQEETLTVKPINSKENITQRGKGKNKQRKNKWRSNNSTTKSPMVNIDNINNTNLLQTLHHIQEQMSIQVQENLDLKKQIQILQEERXKRKPPHISS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.25
3 0.22
4 0.23
5 0.21
6 0.16
7 0.17
8 0.2
9 0.27
10 0.3
11 0.34
12 0.33
13 0.35
14 0.4
15 0.45
16 0.43
17 0.37
18 0.33
19 0.29
20 0.3
21 0.31
22 0.3
23 0.3
24 0.29
25 0.3
26 0.31
27 0.32
28 0.31
29 0.31
30 0.28
31 0.22
32 0.21
33 0.2
34 0.19
35 0.18
36 0.16
37 0.14
38 0.12
39 0.13
40 0.12
41 0.11
42 0.14
43 0.16
44 0.18
45 0.18
46 0.2
47 0.23
48 0.32
49 0.38
50 0.37
51 0.4
52 0.42
53 0.5
54 0.53
55 0.54
56 0.56
57 0.59
58 0.66
59 0.72
60 0.78
61 0.8
62 0.84
63 0.87
64 0.87
65 0.87
66 0.87
67 0.85
68 0.84
69 0.77
70 0.75
71 0.67
72 0.6
73 0.5
74 0.42
75 0.37
76 0.29
77 0.29
78 0.24
79 0.24
80 0.25
81 0.25
82 0.24
83 0.2
84 0.18
85 0.15
86 0.14
87 0.11
88 0.08
89 0.09
90 0.13
91 0.14
92 0.15
93 0.15
94 0.14
95 0.19
96 0.2
97 0.19
98 0.17
99 0.16
100 0.16
101 0.2
102 0.2
103 0.18
104 0.2
105 0.2
106 0.2
107 0.21
108 0.21
109 0.21
110 0.24
111 0.25
112 0.27
113 0.32
114 0.38
115 0.47
116 0.55
117 0.59
118 0.62
119 0.67
120 0.68
121 0.67