Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420H7R1

Protein Details
Accession A0A420H7R1    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-105KEFVHGCHGCKRKKPFTQQKBasic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 6.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041588  Integrase_H2C2  
Pfam View protein in Pfam  
PF17921  Integrase_H2C2  
Amino Acid Sequences MKLKMAGERRLPPQLLAKSYKLSMTDIDVIDNQLYVHGKLYVPQNKELRDNLLKMHHEATGHAGTKGTYGLLSRHYYWMKMPINTKEFVHGCHGCKRKKPFTQQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.47
3 0.46
4 0.43
5 0.39
6 0.39
7 0.39
8 0.31
9 0.27
10 0.22
11 0.21
12 0.23
13 0.19
14 0.2
15 0.18
16 0.18
17 0.16
18 0.15
19 0.11
20 0.08
21 0.09
22 0.08
23 0.08
24 0.09
25 0.08
26 0.11
27 0.2
28 0.24
29 0.26
30 0.32
31 0.35
32 0.35
33 0.38
34 0.36
35 0.34
36 0.31
37 0.29
38 0.25
39 0.26
40 0.25
41 0.24
42 0.24
43 0.19
44 0.17
45 0.16
46 0.18
47 0.17
48 0.17
49 0.16
50 0.15
51 0.13
52 0.14
53 0.13
54 0.09
55 0.06
56 0.06
57 0.07
58 0.11
59 0.14
60 0.15
61 0.21
62 0.21
63 0.22
64 0.23
65 0.31
66 0.31
67 0.33
68 0.37
69 0.39
70 0.42
71 0.43
72 0.42
73 0.4
74 0.37
75 0.35
76 0.37
77 0.34
78 0.34
79 0.41
80 0.5
81 0.49
82 0.57
83 0.65
84 0.67
85 0.72