Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420HZY4

Protein Details
Accession A0A420HZY4    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
67-116GLGTWAYRAHRRRKNKRIKKAVKKAVKEAAKEKAKKKKAARKKAARRKAABasic
NLS Segment(s)
PositionSequence
75-116AHRRRKNKRIKKAVKKAVKEAAKEKAKKKKAARKKAARRKAA
Subcellular Location(s) extr 8, mito 7, plas 6, nucl 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLSIKAMVRLVVIAFFSTPMMIEAFASPTDTTDTADTADTDTGLAQTSSALVRRDASDILLTTATLGLGTWAYRAHRRRKNKRIKKAVKKAVKEAAKEKAKKKKAARKKAARRKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.07
6 0.07
7 0.07
8 0.06
9 0.07
10 0.07
11 0.08
12 0.08
13 0.1
14 0.09
15 0.09
16 0.11
17 0.11
18 0.12
19 0.11
20 0.11
21 0.1
22 0.11
23 0.1
24 0.09
25 0.09
26 0.07
27 0.07
28 0.06
29 0.06
30 0.06
31 0.05
32 0.04
33 0.04
34 0.05
35 0.05
36 0.07
37 0.08
38 0.08
39 0.09
40 0.1
41 0.11
42 0.11
43 0.11
44 0.09
45 0.09
46 0.09
47 0.08
48 0.07
49 0.06
50 0.06
51 0.05
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.05
59 0.07
60 0.15
61 0.22
62 0.32
63 0.41
64 0.52
65 0.63
66 0.73
67 0.83
68 0.86
69 0.91
70 0.92
71 0.95
72 0.95
73 0.95
74 0.94
75 0.92
76 0.87
77 0.84
78 0.81
79 0.76
80 0.7
81 0.64
82 0.64
83 0.64
84 0.65
85 0.67
86 0.68
87 0.71
88 0.75
89 0.8
90 0.81
91 0.83
92 0.87
93 0.9
94 0.9
95 0.93
96 0.95