Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420I0L8

Protein Details
Accession A0A420I0L8    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
146-173KKTKMNEIKNSMRKKRNRTNRIDEDVPNHydrophilic
NLS Segment(s)
PositionSequence
87-93PKNKKKG
139-163SEKRQEIKKTKMNEIKNSMRKKRNR
Subcellular Location(s) nucl 24, mito_nucl 13.833, cyto_nucl 12.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR037650  Loc1  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0051028  P:mRNA transport  
GO:0042273  P:ribosomal large subunit biogenesis  
Amino Acid Sequences MAPSRTSTVKNKYKVTSQTSSTKLQPTRNKTQGGSKSRISKGTKSSQNKKNDVGNQSKFRHKKKIYTEKELDIPTLNMITPIGVQKPKNKKKGKIFVDDTESMMTILSIVNAEKSGQIESKMIKARQMEEIREARRVESEKRQEIKKTKMNEIKNSMRKKRNRTNRIDEDVPNTEPDAALKPRKRVSFVSGDGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.68
3 0.64
4 0.6
5 0.61
6 0.58
7 0.58
8 0.55
9 0.55
10 0.52
11 0.55
12 0.59
13 0.6
14 0.66
15 0.68
16 0.68
17 0.62
18 0.66
19 0.67
20 0.65
21 0.62
22 0.57
23 0.59
24 0.58
25 0.64
26 0.59
27 0.55
28 0.55
29 0.59
30 0.64
31 0.65
32 0.71
33 0.71
34 0.76
35 0.75
36 0.72
37 0.7
38 0.67
39 0.65
40 0.65
41 0.64
42 0.63
43 0.63
44 0.68
45 0.68
46 0.66
47 0.69
48 0.64
49 0.65
50 0.68
51 0.75
52 0.72
53 0.74
54 0.73
55 0.65
56 0.66
57 0.58
58 0.47
59 0.37
60 0.29
61 0.2
62 0.16
63 0.13
64 0.08
65 0.07
66 0.06
67 0.06
68 0.07
69 0.09
70 0.12
71 0.13
72 0.22
73 0.33
74 0.42
75 0.51
76 0.57
77 0.63
78 0.7
79 0.79
80 0.77
81 0.75
82 0.71
83 0.64
84 0.62
85 0.54
86 0.45
87 0.35
88 0.29
89 0.19
90 0.14
91 0.11
92 0.05
93 0.04
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.04
100 0.05
101 0.06
102 0.07
103 0.07
104 0.08
105 0.1
106 0.11
107 0.16
108 0.21
109 0.21
110 0.23
111 0.24
112 0.25
113 0.32
114 0.35
115 0.31
116 0.32
117 0.38
118 0.37
119 0.4
120 0.38
121 0.3
122 0.32
123 0.33
124 0.32
125 0.36
126 0.43
127 0.47
128 0.52
129 0.55
130 0.59
131 0.63
132 0.67
133 0.64
134 0.61
135 0.62
136 0.66
137 0.69
138 0.69
139 0.7
140 0.71
141 0.73
142 0.77
143 0.77
144 0.78
145 0.8
146 0.82
147 0.84
148 0.85
149 0.87
150 0.87
151 0.88
152 0.88
153 0.87
154 0.82
155 0.74
156 0.7
157 0.64
158 0.55
159 0.45
160 0.36
161 0.28
162 0.23
163 0.21
164 0.2
165 0.22
166 0.31
167 0.35
168 0.42
169 0.49
170 0.54
171 0.57
172 0.55
173 0.56
174 0.56