Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HJ10

Protein Details
Accession A0A420HJ10    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPKEKSTTRKTSRPRSEKKKKDPNAPKRGLTBasic
NLS Segment(s)
PositionSequence
8-28TRKTSRPRSEKKKKDPNAPKR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKSTTRKTSRPRSEKKKKDPNAPKRGLTAYMFFAIEQREIVRDENPGITFGQVGKLLGQRWKELDVEQRTPYEVKAAEDKKRYTDEKANYNPDAEEEEEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.92
4 0.93
5 0.94
6 0.94
7 0.91
8 0.92
9 0.92
10 0.92
11 0.92
12 0.87
13 0.78
14 0.72
15 0.65
16 0.58
17 0.48
18 0.39
19 0.3
20 0.25
21 0.23
22 0.18
23 0.17
24 0.15
25 0.13
26 0.11
27 0.09
28 0.08
29 0.1
30 0.11
31 0.1
32 0.1
33 0.11
34 0.12
35 0.12
36 0.12
37 0.1
38 0.09
39 0.09
40 0.08
41 0.09
42 0.07
43 0.07
44 0.07
45 0.09
46 0.1
47 0.14
48 0.15
49 0.15
50 0.16
51 0.18
52 0.17
53 0.17
54 0.25
55 0.27
56 0.3
57 0.3
58 0.3
59 0.3
60 0.29
61 0.27
62 0.23
63 0.18
64 0.16
65 0.24
66 0.28
67 0.34
68 0.4
69 0.41
70 0.42
71 0.47
72 0.48
73 0.46
74 0.49
75 0.49
76 0.53
77 0.6
78 0.62
79 0.57
80 0.55
81 0.49
82 0.41
83 0.38
84 0.3
85 0.24