Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420HBL7

Protein Details
Accession A0A420HBL7   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-32RFLFWNRSKKPKSGYKCKKKFFSSSKITKAKHydrophilic
100-122NKDGSYTKCKRIDRKRDEDDDEDAcidic
NLS Segment(s)
PositionSequence
9-24SKKPKSGYKCKKKFFS
26-27SK
30-30K
Subcellular Location(s) mito_nucl 13, nucl 12.5, mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016191  Ribonuclease/ribotoxin  
Gene Ontology GO:0003723  F:RNA binding  
GO:0004540  F:RNA nuclease activity  
Amino Acid Sequences KRFLFWNRSKKPKSGYKCKKKFFSSSKITKAKNAACRKILKNKQKSAFPSLHTALKFIIPGPYLEWPIKRNGRFWNRWSKNKYRIVLTKRCKVVGAAIRNKDGSYTKCKRIDRKRDEDDDEDDDEDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.81
4 0.87
5 0.89
6 0.89
7 0.86
8 0.86
9 0.83
10 0.82
11 0.8
12 0.79
13 0.8
14 0.79
15 0.74
16 0.69
17 0.68
18 0.65
19 0.65
20 0.65
21 0.61
22 0.59
23 0.65
24 0.65
25 0.68
26 0.71
27 0.71
28 0.72
29 0.75
30 0.74
31 0.73
32 0.72
33 0.68
34 0.62
35 0.54
36 0.5
37 0.43
38 0.42
39 0.35
40 0.31
41 0.24
42 0.21
43 0.19
44 0.13
45 0.13
46 0.08
47 0.09
48 0.09
49 0.1
50 0.12
51 0.13
52 0.14
53 0.13
54 0.19
55 0.25
56 0.25
57 0.27
58 0.35
59 0.42
60 0.47
61 0.51
62 0.56
63 0.57
64 0.65
65 0.68
66 0.68
67 0.69
68 0.71
69 0.69
70 0.64
71 0.66
72 0.66
73 0.69
74 0.67
75 0.66
76 0.6
77 0.58
78 0.52
79 0.44
80 0.43
81 0.41
82 0.44
83 0.44
84 0.44
85 0.46
86 0.46
87 0.45
88 0.39
89 0.36
90 0.3
91 0.32
92 0.36
93 0.43
94 0.5
95 0.58
96 0.65
97 0.72
98 0.79
99 0.79
100 0.83
101 0.83
102 0.83
103 0.83
104 0.77
105 0.72
106 0.65
107 0.57
108 0.47
109 0.38