Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HHF3

Protein Details
Accession A0A420HHF3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-33GSTAARIKRNKKSSQTKFKVRCQKYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPNFVCVGGSTAARIKRNKKSSQTKFKVRCQKYLYTLYAYVWAWLCKSKSICGLALKLNDIST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.38
3 0.47
4 0.55
5 0.62
6 0.67
7 0.74
8 0.79
9 0.84
10 0.84
11 0.85
12 0.84
13 0.85
14 0.85
15 0.77
16 0.75
17 0.68
18 0.64
19 0.59
20 0.58
21 0.51
22 0.43
23 0.4
24 0.32
25 0.3
26 0.25
27 0.21
28 0.16
29 0.14
30 0.12
31 0.15
32 0.16
33 0.18
34 0.2
35 0.21
36 0.26
37 0.29
38 0.32
39 0.32
40 0.34
41 0.35
42 0.35
43 0.35