Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420HGP2

Protein Details
Accession A0A420HGP2   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
52-79SWECHIKESTQKRRRSKKTRLETIPEEQHydrophilic
NLS Segment(s)
PositionSequence
63-69KRRRSKK
Subcellular Location(s) nucl 17.5, mito_nucl 13.166, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
Amino Acid Sequences MSRSCNSYATKKGQSSGLKRSIRRFCNSLRGCKRSYPNDLAHLHVAELWVESWECHIKESTQKRRRSKKTRLETIPEEQEYDEDMMKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.56
3 0.57
4 0.59
5 0.58
6 0.6
7 0.67
8 0.68
9 0.66
10 0.65
11 0.6
12 0.54
13 0.59
14 0.59
15 0.61
16 0.6
17 0.59
18 0.56
19 0.58
20 0.6
21 0.56
22 0.58
23 0.54
24 0.48
25 0.5
26 0.49
27 0.44
28 0.39
29 0.32
30 0.25
31 0.19
32 0.16
33 0.09
34 0.08
35 0.05
36 0.05
37 0.05
38 0.04
39 0.06
40 0.1
41 0.1
42 0.1
43 0.11
44 0.12
45 0.21
46 0.32
47 0.41
48 0.47
49 0.56
50 0.65
51 0.76
52 0.85
53 0.87
54 0.88
55 0.87
56 0.9
57 0.91
58 0.89
59 0.86
60 0.82
61 0.79
62 0.76
63 0.67
64 0.57
65 0.47
66 0.39
67 0.34
68 0.29