Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420I5A0

Protein Details
Accession A0A420I5A0    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
99-125VEAKAKKEPIGKKKPDSKGKGKKVRRKBasic
NLS Segment(s)
PositionSequence
100-125EAKAKKEPIGKKKPDSKGKGKKVRRK
Subcellular Location(s) cyto 16.5, cyto_mito 9.5, nucl 5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029003  CENP-S/Mhf1  
IPR009072  Histone-fold  
Gene Ontology GO:0071821  C:FANCM-MHF complex  
GO:0046982  F:protein heterodimerization activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF15630  CENP-S  
Amino Acid Sequences MTGIKPDLEEQLKASLWHKIGTLVSSETKKLSIQHDVPIDAKPQFIGALTEMVWAQIENVAMDLEAFARHAGRSTVGTDDVLLLTRRNEALEGVLRKWVEAKAKKEPIGKKKPDSKGKGKKVRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.22
4 0.22
5 0.21
6 0.2
7 0.2
8 0.19
9 0.2
10 0.17
11 0.2
12 0.21
13 0.21
14 0.19
15 0.2
16 0.2
17 0.21
18 0.22
19 0.26
20 0.26
21 0.3
22 0.31
23 0.32
24 0.32
25 0.29
26 0.28
27 0.21
28 0.19
29 0.13
30 0.11
31 0.1
32 0.09
33 0.08
34 0.06
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.06
41 0.05
42 0.05
43 0.05
44 0.05
45 0.04
46 0.05
47 0.04
48 0.04
49 0.04
50 0.04
51 0.03
52 0.03
53 0.03
54 0.03
55 0.04
56 0.04
57 0.05
58 0.05
59 0.06
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.09
66 0.09
67 0.08
68 0.09
69 0.08
70 0.07
71 0.07
72 0.09
73 0.09
74 0.09
75 0.09
76 0.08
77 0.11
78 0.17
79 0.19
80 0.18
81 0.21
82 0.21
83 0.21
84 0.22
85 0.23
86 0.26
87 0.31
88 0.36
89 0.43
90 0.5
91 0.56
92 0.62
93 0.68
94 0.69
95 0.73
96 0.76
97 0.75
98 0.78
99 0.83
100 0.86
101 0.85
102 0.86
103 0.86
104 0.88
105 0.9