Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420I3A9

Protein Details
Accession A0A420I3A9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
173-198QIELEIRRLRKRRTKTEPNVKKSINQHydrophilic
NLS Segment(s)
PositionSequence
180-187RLRKRRTK
Subcellular Location(s) nucl 21.5, cyto_nucl 15, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040357  Vma22/CCDC115  
Gene Ontology GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Amino Acid Sequences MKEDNLSDDIENLLSQYLNLVDEYDLLRRRLYMLQVSARQNLARANFNAARGIRYGEELYDSRMQALRLCCVTVDAEKGKRKFTVITKDTIKKKSDPSTASEVKEGALDGLSQEKTMNGDGQTTEDTAITIKHDPIRMFGILTPTSLRLVQTDSIKMVNIIPRLVELDAELAQIELEIRRLRKRRTKTEPNVKKSINQSQPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.07
5 0.07
6 0.07
7 0.08
8 0.07
9 0.09
10 0.11
11 0.16
12 0.18
13 0.19
14 0.19
15 0.18
16 0.21
17 0.23
18 0.26
19 0.26
20 0.28
21 0.34
22 0.4
23 0.43
24 0.43
25 0.41
26 0.37
27 0.33
28 0.31
29 0.27
30 0.26
31 0.23
32 0.28
33 0.29
34 0.29
35 0.33
36 0.29
37 0.28
38 0.23
39 0.24
40 0.17
41 0.17
42 0.17
43 0.12
44 0.15
45 0.14
46 0.18
47 0.19
48 0.18
49 0.17
50 0.18
51 0.18
52 0.19
53 0.2
54 0.19
55 0.16
56 0.16
57 0.14
58 0.14
59 0.15
60 0.12
61 0.14
62 0.15
63 0.21
64 0.28
65 0.29
66 0.3
67 0.3
68 0.3
69 0.31
70 0.34
71 0.38
72 0.33
73 0.38
74 0.42
75 0.48
76 0.53
77 0.54
78 0.5
79 0.43
80 0.47
81 0.48
82 0.49
83 0.43
84 0.41
85 0.44
86 0.45
87 0.42
88 0.37
89 0.3
90 0.24
91 0.22
92 0.17
93 0.09
94 0.06
95 0.04
96 0.04
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.08
103 0.08
104 0.1
105 0.07
106 0.08
107 0.08
108 0.1
109 0.1
110 0.1
111 0.1
112 0.08
113 0.08
114 0.07
115 0.07
116 0.08
117 0.08
118 0.1
119 0.13
120 0.16
121 0.16
122 0.18
123 0.21
124 0.19
125 0.18
126 0.18
127 0.19
128 0.16
129 0.17
130 0.16
131 0.14
132 0.15
133 0.15
134 0.14
135 0.1
136 0.12
137 0.15
138 0.17
139 0.17
140 0.18
141 0.18
142 0.17
143 0.17
144 0.17
145 0.18
146 0.17
147 0.15
148 0.14
149 0.14
150 0.16
151 0.15
152 0.13
153 0.09
154 0.1
155 0.1
156 0.1
157 0.09
158 0.07
159 0.07
160 0.07
161 0.07
162 0.05
163 0.09
164 0.13
165 0.16
166 0.26
167 0.34
168 0.44
169 0.53
170 0.63
171 0.7
172 0.77
173 0.85
174 0.87
175 0.91
176 0.92
177 0.9
178 0.9
179 0.81
180 0.77
181 0.74
182 0.74