Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420HAN2

Protein Details
Accession A0A420HAN2    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-36SAYYSRYQTKYKRRRIGKTDYYARKRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 8, cyto 8, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR005485  Rbsml_L5_euk/L18_arc  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0008097  F:5S rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF17144  Ribosomal_L5e  
CDD cd00432  Ribosomal_L18_L5e  
Amino Acid Sequences MPFTKLVKNSAYYSRYQTKYKRRRIGKTDYYARKRLITQAKNKYNTPKYRLVIRFTNRDIVAQIVTSEITGDKVFCAAYSHELKAYGIEHGLTNWAAAYCTGLLIARRVLKKLGLENEFVGVEEADGEYNLTEASDGDLRRPFKAILDVGLARTSTGARVFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.53
4 0.59
5 0.62
6 0.69
7 0.77
8 0.8
9 0.8
10 0.86
11 0.86
12 0.87
13 0.86
14 0.85
15 0.85
16 0.86
17 0.83
18 0.79
19 0.73
20 0.65
21 0.57
22 0.56
23 0.56
24 0.54
25 0.57
26 0.62
27 0.69
28 0.69
29 0.71
30 0.72
31 0.71
32 0.7
33 0.67
34 0.64
35 0.58
36 0.64
37 0.64
38 0.59
39 0.58
40 0.55
41 0.55
42 0.49
43 0.52
44 0.43
45 0.39
46 0.34
47 0.27
48 0.22
49 0.15
50 0.13
51 0.07
52 0.07
53 0.06
54 0.06
55 0.04
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.1
66 0.12
67 0.13
68 0.13
69 0.13
70 0.13
71 0.13
72 0.13
73 0.09
74 0.06
75 0.06
76 0.06
77 0.06
78 0.07
79 0.06
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.04
87 0.04
88 0.04
89 0.05
90 0.05
91 0.06
92 0.09
93 0.13
94 0.14
95 0.16
96 0.17
97 0.18
98 0.21
99 0.26
100 0.3
101 0.27
102 0.28
103 0.27
104 0.28
105 0.26
106 0.23
107 0.18
108 0.1
109 0.08
110 0.07
111 0.06
112 0.05
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.06
122 0.1
123 0.11
124 0.14
125 0.2
126 0.22
127 0.23
128 0.25
129 0.23
130 0.22
131 0.28
132 0.26
133 0.22
134 0.26
135 0.26
136 0.25
137 0.26
138 0.24
139 0.17
140 0.17
141 0.15
142 0.12