Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7X9R4

Protein Details
Accession G7X9R4   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
52-73DGQPIQRIRRRRRKDEELLSQDHydrophilic
NLS Segment(s)
PositionSequence
60-64RRRRR
Subcellular Location(s) extr 10, mito 9, nucl 2, plas 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016757  F:glycosyltransferase activity  
Amino Acid Sequences MPPHLHPRSRSTSSLFAGTLLASLVVVGLPHVFPCPAPRRTFADSEMIMSADGQPIQRIRRRRRKDEELLSQDGNLLAQTQPAADEEVSTFLQLEEEAQRLAKAGHECPVPKPRGILGELLGFTSSGDMPTSTTTQSQRVGEGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.4
3 0.32
4 0.27
5 0.23
6 0.18
7 0.11
8 0.08
9 0.05
10 0.04
11 0.04
12 0.03
13 0.03
14 0.03
15 0.04
16 0.04
17 0.05
18 0.06
19 0.06
20 0.06
21 0.14
22 0.21
23 0.26
24 0.28
25 0.32
26 0.37
27 0.41
28 0.44
29 0.38
30 0.37
31 0.32
32 0.31
33 0.27
34 0.21
35 0.17
36 0.15
37 0.13
38 0.08
39 0.08
40 0.06
41 0.07
42 0.1
43 0.15
44 0.19
45 0.29
46 0.38
47 0.49
48 0.58
49 0.66
50 0.73
51 0.78
52 0.82
53 0.81
54 0.81
55 0.76
56 0.7
57 0.6
58 0.51
59 0.41
60 0.32
61 0.23
62 0.13
63 0.08
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.06
71 0.05
72 0.05
73 0.06
74 0.08
75 0.08
76 0.08
77 0.08
78 0.06
79 0.07
80 0.06
81 0.07
82 0.06
83 0.07
84 0.07
85 0.07
86 0.07
87 0.08
88 0.08
89 0.11
90 0.12
91 0.13
92 0.17
93 0.2
94 0.21
95 0.27
96 0.35
97 0.34
98 0.32
99 0.33
100 0.31
101 0.32
102 0.32
103 0.28
104 0.21
105 0.23
106 0.22
107 0.21
108 0.19
109 0.14
110 0.13
111 0.12
112 0.1
113 0.07
114 0.07
115 0.07
116 0.08
117 0.11
118 0.13
119 0.13
120 0.18
121 0.2
122 0.24
123 0.29
124 0.29