Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HZR1

Protein Details
Accession A0A420HZR1    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
66-89AETMHRKRVERLKRREKRNKRLKSBasic
NLS Segment(s)
PositionSequence
26-89TMKAKEKEMKQEKEEARNRRIEAIRAKRTAKEEKARYEKMAETMHRKRVERLKRREKRNKRLKS
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MPTLLKLKAGDSSYAKRLEERKAMETMKAKEKEMKQEKEEARNRRIEAIRAKRTAKEEKARYEKMAETMHRKRVERLKRREKRNKRLKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.36
4 0.39
5 0.41
6 0.43
7 0.42
8 0.39
9 0.42
10 0.43
11 0.43
12 0.45
13 0.43
14 0.45
15 0.42
16 0.4
17 0.42
18 0.44
19 0.5
20 0.52
21 0.53
22 0.46
23 0.53
24 0.55
25 0.58
26 0.63
27 0.59
28 0.54
29 0.54
30 0.52
31 0.5
32 0.47
33 0.42
34 0.44
35 0.47
36 0.49
37 0.49
38 0.5
39 0.47
40 0.51
41 0.54
42 0.52
43 0.52
44 0.52
45 0.57
46 0.64
47 0.63
48 0.59
49 0.54
50 0.48
51 0.44
52 0.44
53 0.39
54 0.4
55 0.44
56 0.51
57 0.53
58 0.53
59 0.56
60 0.6
61 0.66
62 0.68
63 0.72
64 0.75
65 0.78
66 0.88
67 0.92
68 0.93
69 0.94