Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420I291

Protein Details
Accession A0A420I291    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-75GIYVLGKYKKEKKKNKELKQQLGQHydrophilic
NLS Segment(s)
PositionSequence
58-67KYKKEKKKNK
Subcellular Location(s) extr 20, E.R. 4, mito 2
Family & Domain DBs
Amino Acid Sequences MFSIRQIFSLAFLAFFSLPLIIALPLDTDTTSSGRALEPRSKLGKAAAAATGIYVLGKYKKEKKKNKELKQQLGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.06
5 0.06
6 0.06
7 0.07
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.06
14 0.05
15 0.05
16 0.07
17 0.07
18 0.08
19 0.08
20 0.08
21 0.08
22 0.1
23 0.13
24 0.16
25 0.17
26 0.21
27 0.24
28 0.24
29 0.24
30 0.23
31 0.23
32 0.19
33 0.19
34 0.15
35 0.12
36 0.12
37 0.11
38 0.1
39 0.07
40 0.06
41 0.04
42 0.06
43 0.08
44 0.12
45 0.19
46 0.29
47 0.39
48 0.5
49 0.61
50 0.7
51 0.78
52 0.86
53 0.91
54 0.92
55 0.93