Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420I4H4

Protein Details
Accession A0A420I4H4    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-40LKIPWRLSKFQKARQRKRLRAVDEVHydrophilic
74-109KDKYTIFDRKEKKYRKSLRKLPKWTRVSQRINPPGYHydrophilic
NLS Segment(s)
PositionSequence
82-96RKEKKYRKSLRKLPK
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGVFKQTNTLFGGLLKIPWRLSKFQKARQRKRLRAVDEVVAVVDKALAKQGTSVKALEIWKKEMPIEQEMLPKDKYTIFDRKEKKYRKSLRKLPKWTRVSQRINPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.16
4 0.16
5 0.17
6 0.22
7 0.25
8 0.28
9 0.35
10 0.43
11 0.5
12 0.57
13 0.66
14 0.72
15 0.79
16 0.85
17 0.89
18 0.87
19 0.88
20 0.88
21 0.83
22 0.79
23 0.71
24 0.63
25 0.53
26 0.44
27 0.34
28 0.24
29 0.19
30 0.11
31 0.08
32 0.05
33 0.04
34 0.06
35 0.06
36 0.06
37 0.09
38 0.12
39 0.13
40 0.14
41 0.14
42 0.12
43 0.16
44 0.18
45 0.19
46 0.18
47 0.2
48 0.2
49 0.21
50 0.21
51 0.2
52 0.22
53 0.2
54 0.21
55 0.18
56 0.22
57 0.23
58 0.26
59 0.23
60 0.2
61 0.19
62 0.19
63 0.2
64 0.21
65 0.3
66 0.3
67 0.39
68 0.46
69 0.54
70 0.63
71 0.69
72 0.71
73 0.73
74 0.8
75 0.82
76 0.86
77 0.87
78 0.88
79 0.9
80 0.93
81 0.92
82 0.92
83 0.88
84 0.86
85 0.86
86 0.86
87 0.84
88 0.81
89 0.82