Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420HH30

Protein Details
Accession A0A420HH30   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-126HPTVRPTECRRARKWKNPRPKVLKEQSFYHydrophilic
NLS Segment(s)
PositionSequence
108-118RARKWKNPRPK
Subcellular Location(s) nucl 11, mito 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MLLNIDIVARQPALVPPTITASIPAFASPTTTHSPIELPLSSQISIDVEFSTASGFPGPEQHEQPRPQAPLQKQFSPDRPEVLIKAYLAEKTAWLVQHPTVRPTECRRARKWKNPRPKVLKEQSFYMPKERRDLDGNVIAVKANWTNEEIMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.19
5 0.2
6 0.19
7 0.18
8 0.17
9 0.16
10 0.15
11 0.14
12 0.11
13 0.09
14 0.12
15 0.1
16 0.14
17 0.18
18 0.19
19 0.19
20 0.19
21 0.21
22 0.19
23 0.22
24 0.18
25 0.14
26 0.16
27 0.18
28 0.17
29 0.16
30 0.15
31 0.12
32 0.12
33 0.12
34 0.09
35 0.07
36 0.06
37 0.06
38 0.07
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.1
45 0.13
46 0.15
47 0.18
48 0.22
49 0.28
50 0.3
51 0.33
52 0.34
53 0.33
54 0.32
55 0.37
56 0.37
57 0.4
58 0.42
59 0.42
60 0.41
61 0.42
62 0.45
63 0.43
64 0.4
65 0.32
66 0.3
67 0.27
68 0.24
69 0.23
70 0.18
71 0.13
72 0.13
73 0.12
74 0.11
75 0.11
76 0.1
77 0.08
78 0.08
79 0.1
80 0.09
81 0.09
82 0.11
83 0.12
84 0.19
85 0.19
86 0.21
87 0.22
88 0.23
89 0.28
90 0.33
91 0.41
92 0.44
93 0.51
94 0.56
95 0.65
96 0.73
97 0.79
98 0.84
99 0.83
100 0.86
101 0.88
102 0.92
103 0.9
104 0.89
105 0.89
106 0.89
107 0.87
108 0.78
109 0.73
110 0.7
111 0.67
112 0.6
113 0.59
114 0.55
115 0.49
116 0.53
117 0.51
118 0.47
119 0.45
120 0.46
121 0.43
122 0.42
123 0.41
124 0.34
125 0.32
126 0.28
127 0.23
128 0.23
129 0.18
130 0.13
131 0.14
132 0.15