Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HRY2

Protein Details
Accession A0A420HRY2    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPSHKSFRTKQKLAKAQKQNRPIPQWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 11.833, cyto_nucl 9.333, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRGDIGERLESASDQFDRNSRYIEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.84
4 0.84
5 0.86
6 0.83
7 0.8
8 0.76
9 0.74
10 0.68
11 0.66
12 0.66
13 0.6
14 0.57
15 0.51
16 0.48
17 0.45
18 0.44
19 0.42
20 0.35
21 0.33
22 0.28
23 0.27
24 0.27
25 0.23
26 0.19
27 0.14
28 0.13
29 0.12
30 0.12
31 0.11
32 0.1
33 0.13
34 0.12
35 0.13
36 0.14
37 0.18
38 0.22
39 0.23