Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HWP6

Protein Details
Accession A0A420HWP6    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPANTGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 14, cyto_nucl 10.833, mito_nucl 10.833, mito 6.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPANTGAKKQKKKWSKGKVKDKAQHAVILDKVTSDKLYKDVQSYRLVTVATLVDRLKINGSLARRCLKDLEQKGQIKKVVGHSKLQIYTRAVTAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.89
4 0.9
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.39
16 0.32
17 0.25
18 0.18
19 0.16
20 0.13
21 0.13
22 0.1
23 0.09
24 0.11
25 0.14
26 0.15
27 0.18
28 0.2
29 0.23
30 0.27
31 0.27
32 0.25
33 0.23
34 0.22
35 0.18
36 0.16
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.09
45 0.09
46 0.1
47 0.12
48 0.15
49 0.17
50 0.21
51 0.26
52 0.26
53 0.26
54 0.28
55 0.3
56 0.37
57 0.4
58 0.43
59 0.47
60 0.53
61 0.56
62 0.59
63 0.56
64 0.48
65 0.46
66 0.48
67 0.49
68 0.45
69 0.46
70 0.45
71 0.49
72 0.52
73 0.5
74 0.46
75 0.39
76 0.39
77 0.35