Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HSP9

Protein Details
Accession A0A420HSP9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
56-81VSLLKMFKECWKRNKNDERTSTKDAKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039870  Coa4-like  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSKTDSDSKLAAAIEDDDEPDDWDKRIFSTGCAAENTKMNDCFYEKRDWRLCKDEVSLLKMFKECWKRNKNDERTSTKDAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.1
5 0.1
6 0.11
7 0.12
8 0.12
9 0.11
10 0.11
11 0.11
12 0.11
13 0.15
14 0.14
15 0.13
16 0.18
17 0.18
18 0.19
19 0.2
20 0.21
21 0.18
22 0.21
23 0.22
24 0.19
25 0.18
26 0.17
27 0.16
28 0.18
29 0.19
30 0.19
31 0.26
32 0.25
33 0.31
34 0.39
35 0.42
36 0.45
37 0.48
38 0.47
39 0.41
40 0.42
41 0.4
42 0.35
43 0.37
44 0.35
45 0.29
46 0.3
47 0.27
48 0.26
49 0.28
50 0.36
51 0.38
52 0.46
53 0.55
54 0.61
55 0.71
56 0.81
57 0.83
58 0.83
59 0.85
60 0.83
61 0.82