Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7XI56

Protein Details
Accession G7XI56   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-66QYHEQRWKRNIDRRWHGHNTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, plas 4, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015889  Intradiol_dOase_core  
Gene Ontology GO:0005506  F:iron ion binding  
GO:0016702  F:oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen  
Amino Acid Sequences MHLSSILPVLALVATAISHAGPHDILSHSEISRRSAMGMMCRKSISQYHEQRWKRNIDRRWHGHNTTFSVHTEAPYFETVQNGTCVLTPEVTQGPYVYPPSQILRQDISEGQPGVPLWLDIGVLNMATCSYSSFTHLSPNTPFPEILKQEGINESDFKMGVTDLHTDDTTFLRGMWPTDKHGMMEMKTIFPGFYIQRTIHIHVQVHTDWSLRENGTIMTGNTVSTGQLYFDEALEQKIMSLEPYASHTQINRTTNADDLVFPYDTAGGFNPVVNVVPMDGKDVTKGMIGYITLGVDTSAIEHGDNYVGDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.04
5 0.04
6 0.05
7 0.07
8 0.07
9 0.07
10 0.1
11 0.11
12 0.13
13 0.15
14 0.19
15 0.17
16 0.22
17 0.23
18 0.24
19 0.25
20 0.24
21 0.22
22 0.23
23 0.24
24 0.29
25 0.36
26 0.35
27 0.35
28 0.35
29 0.34
30 0.34
31 0.38
32 0.35
33 0.37
34 0.44
35 0.51
36 0.61
37 0.66
38 0.7
39 0.72
40 0.75
41 0.75
42 0.75
43 0.74
44 0.74
45 0.79
46 0.79
47 0.81
48 0.79
49 0.74
50 0.71
51 0.68
52 0.62
53 0.55
54 0.49
55 0.41
56 0.37
57 0.33
58 0.27
59 0.23
60 0.19
61 0.18
62 0.17
63 0.19
64 0.14
65 0.16
66 0.15
67 0.14
68 0.15
69 0.12
70 0.11
71 0.1
72 0.12
73 0.11
74 0.11
75 0.1
76 0.12
77 0.14
78 0.14
79 0.13
80 0.11
81 0.11
82 0.13
83 0.15
84 0.13
85 0.12
86 0.14
87 0.17
88 0.21
89 0.22
90 0.23
91 0.22
92 0.22
93 0.23
94 0.22
95 0.21
96 0.2
97 0.19
98 0.16
99 0.15
100 0.14
101 0.12
102 0.11
103 0.09
104 0.06
105 0.05
106 0.05
107 0.04
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.03
114 0.03
115 0.03
116 0.04
117 0.05
118 0.06
119 0.09
120 0.1
121 0.11
122 0.17
123 0.17
124 0.19
125 0.19
126 0.23
127 0.22
128 0.21
129 0.21
130 0.17
131 0.23
132 0.22
133 0.21
134 0.2
135 0.18
136 0.18
137 0.2
138 0.19
139 0.14
140 0.13
141 0.12
142 0.1
143 0.1
144 0.09
145 0.07
146 0.06
147 0.06
148 0.07
149 0.08
150 0.08
151 0.09
152 0.09
153 0.09
154 0.1
155 0.1
156 0.1
157 0.08
158 0.07
159 0.07
160 0.08
161 0.09
162 0.12
163 0.13
164 0.15
165 0.18
166 0.18
167 0.18
168 0.21
169 0.21
170 0.18
171 0.21
172 0.19
173 0.16
174 0.16
175 0.16
176 0.13
177 0.11
178 0.13
179 0.09
180 0.1
181 0.13
182 0.12
183 0.18
184 0.21
185 0.24
186 0.25
187 0.28
188 0.27
189 0.26
190 0.3
191 0.25
192 0.24
193 0.21
194 0.18
195 0.14
196 0.15
197 0.17
198 0.13
199 0.13
200 0.11
201 0.11
202 0.12
203 0.13
204 0.11
205 0.11
206 0.11
207 0.1
208 0.1
209 0.1
210 0.08
211 0.08
212 0.08
213 0.06
214 0.06
215 0.08
216 0.08
217 0.08
218 0.1
219 0.09
220 0.1
221 0.1
222 0.1
223 0.08
224 0.08
225 0.08
226 0.07
227 0.08
228 0.07
229 0.07
230 0.12
231 0.15
232 0.15
233 0.17
234 0.18
235 0.23
236 0.29
237 0.31
238 0.29
239 0.3
240 0.3
241 0.3
242 0.3
243 0.25
244 0.18
245 0.18
246 0.19
247 0.16
248 0.15
249 0.14
250 0.13
251 0.12
252 0.13
253 0.12
254 0.11
255 0.11
256 0.11
257 0.11
258 0.11
259 0.11
260 0.1
261 0.1
262 0.08
263 0.09
264 0.09
265 0.12
266 0.13
267 0.13
268 0.14
269 0.14
270 0.14
271 0.14
272 0.14
273 0.11
274 0.11
275 0.11
276 0.11
277 0.11
278 0.11
279 0.09
280 0.09
281 0.08
282 0.07
283 0.07
284 0.06
285 0.07
286 0.07
287 0.07
288 0.07
289 0.09
290 0.1