Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HY99

Protein Details
Accession A0A420HY99    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-72KGKSLFKPSKKMRQKFLTKPSAWHydrophilic
NLS Segment(s)
PositionSequence
37-64KTYKKFGPKLTGPKGKSLFKPSKKMRQK
Subcellular Location(s) mito 20.5, cyto_mito 12.333, cyto_nucl 3.333, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR024937  Domain_X  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043231  C:intracellular membrane-bounded organelle  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF01348  Intron_maturas2  
Amino Acid Sequences MGFSHNYGRLASYIEFILKQSCAKLLARKFKLGTMAKTYKKFGPKLTGPKGKSLFKPSKKMRQKFLTKPSAWCTIPIKVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.15
5 0.12
6 0.12
7 0.12
8 0.12
9 0.13
10 0.15
11 0.22
12 0.28
13 0.38
14 0.39
15 0.43
16 0.42
17 0.41
18 0.48
19 0.43
20 0.39
21 0.37
22 0.42
23 0.42
24 0.44
25 0.45
26 0.41
27 0.43
28 0.42
29 0.37
30 0.37
31 0.39
32 0.46
33 0.53
34 0.57
35 0.52
36 0.58
37 0.6
38 0.57
39 0.54
40 0.54
41 0.56
42 0.54
43 0.64
44 0.64
45 0.7
46 0.76
47 0.78
48 0.79
49 0.79
50 0.82
51 0.81
52 0.83
53 0.83
54 0.75
55 0.75
56 0.7
57 0.68
58 0.58
59 0.53
60 0.47