Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HQU2

Protein Details
Accession A0A420HQU2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
40-59QVLRGCRKARKARKAVSPALHydrophilic
145-164GNRQTSRSKYGTKKPKKAAIHydrophilic
NLS Segment(s)
PositionSequence
46-58RKARKARKAVSPA
157-161KKPKK
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005679  Ribosomal_S12_bac  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03368  Ribosomal_S12  
Amino Acid Sequences MFMKKPLIFRSIQSSINSFKQLFLSRNFTSTSTLSATYNQVLRGCRKARKARKAVSPALRVAKAPNLKGVCVKVETTKPKKPNSAERKVARVRLSTGKLVTAYIPGEGHNAQQHSVVLVRGGRCQDCPGVRYHLVRGALDLGGVGNRQTSRSKYGTKKPKKAAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.39
4 0.41
5 0.32
6 0.29
7 0.31
8 0.33
9 0.33
10 0.33
11 0.37
12 0.33
13 0.35
14 0.35
15 0.31
16 0.3
17 0.27
18 0.25
19 0.2
20 0.2
21 0.19
22 0.19
23 0.2
24 0.19
25 0.2
26 0.19
27 0.19
28 0.21
29 0.24
30 0.3
31 0.34
32 0.38
33 0.46
34 0.55
35 0.63
36 0.71
37 0.76
38 0.76
39 0.8
40 0.81
41 0.8
42 0.77
43 0.7
44 0.64
45 0.59
46 0.52
47 0.43
48 0.36
49 0.35
50 0.3
51 0.26
52 0.28
53 0.24
54 0.24
55 0.26
56 0.26
57 0.2
58 0.18
59 0.18
60 0.15
61 0.21
62 0.3
63 0.34
64 0.4
65 0.45
66 0.47
67 0.53
68 0.54
69 0.59
70 0.59
71 0.61
72 0.63
73 0.6
74 0.64
75 0.61
76 0.62
77 0.54
78 0.45
79 0.4
80 0.38
81 0.38
82 0.32
83 0.29
84 0.25
85 0.23
86 0.22
87 0.18
88 0.13
89 0.11
90 0.09
91 0.09
92 0.08
93 0.1
94 0.1
95 0.11
96 0.13
97 0.13
98 0.13
99 0.13
100 0.13
101 0.11
102 0.12
103 0.1
104 0.09
105 0.11
106 0.11
107 0.14
108 0.17
109 0.17
110 0.17
111 0.19
112 0.23
113 0.23
114 0.24
115 0.24
116 0.28
117 0.31
118 0.32
119 0.32
120 0.32
121 0.32
122 0.3
123 0.28
124 0.23
125 0.2
126 0.17
127 0.15
128 0.1
129 0.08
130 0.09
131 0.07
132 0.08
133 0.09
134 0.12
135 0.16
136 0.2
137 0.26
138 0.32
139 0.41
140 0.47
141 0.57
142 0.66
143 0.73
144 0.79