Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HI25

Protein Details
Accession A0A420HI25    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
41-74ESRTTLTRKENRRFKRKIKKREEERMGLKKNKKTBasic
NLS Segment(s)
PositionSequence
48-75RKENRRFKRKIKKREEERMGLKKNKKTT
Subcellular Location(s) mito 18, mito_nucl 11.833, cyto_mito 10.833, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MGRKNRWSLVIIWLVQREVLPFFHQLRDILFEGESSSMPLESRTTLTRKENRRFKRKIKKREEERMGLKKNKKTTPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.24
4 0.18
5 0.14
6 0.13
7 0.13
8 0.16
9 0.17
10 0.18
11 0.19
12 0.18
13 0.17
14 0.2
15 0.19
16 0.15
17 0.14
18 0.12
19 0.12
20 0.12
21 0.11
22 0.07
23 0.06
24 0.05
25 0.06
26 0.06
27 0.06
28 0.06
29 0.08
30 0.1
31 0.12
32 0.16
33 0.24
34 0.32
35 0.41
36 0.5
37 0.58
38 0.66
39 0.74
40 0.79
41 0.83
42 0.86
43 0.88
44 0.89
45 0.9
46 0.91
47 0.91
48 0.93
49 0.91
50 0.89
51 0.88
52 0.87
53 0.85
54 0.84
55 0.82
56 0.79
57 0.79