Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420I2Y7

Protein Details
Accession A0A420I2Y7   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
36-59IKNWVHLPPKLRNRRPQCLRQGFCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MDTIHAWILSLALLTKHVTHASTEQITSLPEHVLWIKNWVHLPPKLRNRRPQCLRQGFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.1
5 0.11
6 0.12
7 0.13
8 0.16
9 0.16
10 0.16
11 0.14
12 0.14
13 0.14
14 0.13
15 0.12
16 0.08
17 0.06
18 0.07
19 0.08
20 0.1
21 0.09
22 0.14
23 0.14
24 0.17
25 0.18
26 0.2
27 0.23
28 0.26
29 0.31
30 0.36
31 0.46
32 0.55
33 0.62
34 0.7
35 0.74
36 0.82
37 0.85
38 0.85
39 0.86