Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HWQ4

Protein Details
Accession A0A420HWQ4    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
35-54GCKRLEPSAKKKKKNEYSTGHydrophilic
NLS Segment(s)
PositionSequence
44-47KKKK
Subcellular Location(s) mito 20, mito_nucl 12.499, cyto_mito 11.999, cyto_nucl 4.166, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MNSFTEATSKTPLFLRAPAGIKLKDNEIALWSYAGCKRLEPSAKKKKKNEYSTGVSFKVQQIYVFSHPIKRVSVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.25
4 0.28
5 0.31
6 0.34
7 0.31
8 0.31
9 0.3
10 0.29
11 0.26
12 0.24
13 0.2
14 0.16
15 0.16
16 0.14
17 0.13
18 0.1
19 0.1
20 0.11
21 0.13
22 0.11
23 0.11
24 0.11
25 0.17
26 0.24
27 0.28
28 0.37
29 0.47
30 0.56
31 0.64
32 0.71
33 0.76
34 0.8
35 0.82
36 0.8
37 0.76
38 0.75
39 0.74
40 0.71
41 0.62
42 0.52
43 0.45
44 0.4
45 0.36
46 0.29
47 0.22
48 0.2
49 0.24
50 0.26
51 0.3
52 0.29
53 0.31
54 0.33
55 0.35