Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420HQZ9

Protein Details
Accession A0A420HQZ9   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MTQTRSRQRKERFRQEGNKADRQLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTQTRSRQRKERFRQEGNKADRQLSKQSGSEECNLHFTFVPNPLLLLTSLVTSSSRNKADEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.88
4 0.84
5 0.81
6 0.72
7 0.67
8 0.6
9 0.54
10 0.52
11 0.46
12 0.41
13 0.34
14 0.35
15 0.33
16 0.32
17 0.31
18 0.25
19 0.22
20 0.24
21 0.22
22 0.21
23 0.18
24 0.17
25 0.16
26 0.18
27 0.19
28 0.14
29 0.14
30 0.13
31 0.13
32 0.12
33 0.11
34 0.08
35 0.07
36 0.07
37 0.08
38 0.08
39 0.1
40 0.15
41 0.21
42 0.23