Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420HX62

Protein Details
Accession A0A420HX62    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
36-55RTTPRKIKKNAARNERRKAABasic
NLS Segment(s)
PositionSequence
39-57PRKIKKNAARNERRKAARK
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
Amino Acid Sequences MKSQKAAFKTAHKSHPLNIKKPQQSVVVGTTTAVARTTPRKIKKNAARNERRKAARKTAHLLKAQQQQEQQQEQKQVPKNEVNVEENNNKNNVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.65
4 0.62
5 0.64
6 0.66
7 0.65
8 0.65
9 0.63
10 0.56
11 0.5
12 0.47
13 0.4
14 0.31
15 0.25
16 0.21
17 0.19
18 0.15
19 0.13
20 0.1
21 0.07
22 0.08
23 0.12
24 0.19
25 0.26
26 0.34
27 0.41
28 0.45
29 0.55
30 0.62
31 0.68
32 0.7
33 0.73
34 0.76
35 0.77
36 0.81
37 0.79
38 0.76
39 0.75
40 0.72
41 0.72
42 0.68
43 0.65
44 0.65
45 0.65
46 0.65
47 0.61
48 0.58
49 0.55
50 0.57
51 0.54
52 0.51
53 0.45
54 0.44
55 0.48
56 0.52
57 0.48
58 0.45
59 0.48
60 0.48
61 0.53
62 0.55
63 0.52
64 0.51
65 0.52
66 0.51
67 0.52
68 0.53
69 0.49
70 0.46
71 0.48
72 0.5
73 0.49
74 0.48