Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420I7Y0

Protein Details
Accession A0A420I7Y0   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
222-246LSEVDKFMAKRRRKQIPLCRTCHLEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 11.5, nucl 9.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024937  Domain_X  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043231  C:intracellular membrane-bounded organelle  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF01348  Intron_maturas2  
Amino Acid Sequences MLGVRGPRSDAVNFLQIIKTMLNESLLLELSMEKSKITNPRLEPALFLGTLIAISKHVSSTKGKNQRLKVVSQLRMLAPMDRIAKKLNTAGFLSTKYKKNIIKLYNSVLRGYLNYYSFTHNYSRVASSLEFILKTSCAKLLAAKFKLGSVTKVIAKFGKNLKGDDKTGFYKPSYKINDRIKTLFASYLSGATIDSLKCVKCGSTYRVEMHHVRLLSDLNPKLSEVDKFMAKRRRKQIPLCRTCHLEHQKNHKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.22
4 0.23
5 0.2
6 0.17
7 0.13
8 0.13
9 0.13
10 0.12
11 0.12
12 0.12
13 0.12
14 0.11
15 0.09
16 0.09
17 0.11
18 0.13
19 0.12
20 0.11
21 0.11
22 0.17
23 0.25
24 0.29
25 0.34
26 0.35
27 0.4
28 0.44
29 0.44
30 0.4
31 0.34
32 0.33
33 0.25
34 0.22
35 0.16
36 0.12
37 0.11
38 0.11
39 0.07
40 0.05
41 0.06
42 0.06
43 0.08
44 0.09
45 0.12
46 0.16
47 0.24
48 0.34
49 0.43
50 0.5
51 0.57
52 0.61
53 0.67
54 0.66
55 0.6
56 0.6
57 0.59
58 0.56
59 0.51
60 0.48
61 0.39
62 0.39
63 0.37
64 0.28
65 0.2
66 0.2
67 0.23
68 0.21
69 0.22
70 0.22
71 0.22
72 0.22
73 0.25
74 0.23
75 0.2
76 0.19
77 0.2
78 0.19
79 0.21
80 0.24
81 0.26
82 0.29
83 0.29
84 0.34
85 0.35
86 0.4
87 0.46
88 0.46
89 0.47
90 0.45
91 0.49
92 0.48
93 0.46
94 0.39
95 0.31
96 0.27
97 0.21
98 0.2
99 0.16
100 0.12
101 0.13
102 0.14
103 0.16
104 0.17
105 0.18
106 0.18
107 0.17
108 0.17
109 0.16
110 0.16
111 0.13
112 0.14
113 0.12
114 0.11
115 0.11
116 0.1
117 0.09
118 0.08
119 0.08
120 0.07
121 0.08
122 0.08
123 0.07
124 0.07
125 0.07
126 0.11
127 0.15
128 0.23
129 0.23
130 0.24
131 0.23
132 0.23
133 0.27
134 0.23
135 0.2
136 0.14
137 0.16
138 0.18
139 0.19
140 0.2
141 0.19
142 0.19
143 0.23
144 0.26
145 0.31
146 0.29
147 0.31
148 0.35
149 0.36
150 0.37
151 0.34
152 0.33
153 0.29
154 0.3
155 0.3
156 0.26
157 0.29
158 0.28
159 0.35
160 0.39
161 0.4
162 0.46
163 0.54
164 0.6
165 0.57
166 0.58
167 0.5
168 0.45
169 0.42
170 0.35
171 0.25
172 0.21
173 0.17
174 0.16
175 0.14
176 0.12
177 0.1
178 0.09
179 0.1
180 0.08
181 0.09
182 0.11
183 0.11
184 0.12
185 0.13
186 0.12
187 0.15
188 0.21
189 0.25
190 0.3
191 0.34
192 0.37
193 0.4
194 0.44
195 0.43
196 0.42
197 0.41
198 0.33
199 0.29
200 0.28
201 0.26
202 0.24
203 0.3
204 0.27
205 0.25
206 0.25
207 0.25
208 0.26
209 0.26
210 0.24
211 0.2
212 0.22
213 0.25
214 0.28
215 0.36
216 0.44
217 0.5
218 0.58
219 0.64
220 0.71
221 0.74
222 0.83
223 0.85
224 0.87
225 0.89
226 0.85
227 0.81
228 0.75
229 0.68
230 0.69
231 0.68
232 0.67
233 0.65