Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420HY32

Protein Details
Accession A0A420HY32   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
24-50ENYLTMVRTKRKRKREHQQQQVEERITHydrophilic
NLS Segment(s)
PositionSequence
33-38KRKRKR
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAGALTLLVTEAENDSESHPENSENYLTMVRTKRKRKREHQQQQVEERITQLVAERISQRHLSQKSVMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.11
4 0.13
5 0.13
6 0.13
7 0.13
8 0.14
9 0.16
10 0.15
11 0.13
12 0.13
13 0.13
14 0.12
15 0.17
16 0.21
17 0.26
18 0.34
19 0.44
20 0.52
21 0.61
22 0.71
23 0.76
24 0.82
25 0.86
26 0.88
27 0.89
28 0.9
29 0.87
30 0.84
31 0.81
32 0.71
33 0.59
34 0.5
35 0.39
36 0.29
37 0.22
38 0.16
39 0.12
40 0.11
41 0.14
42 0.16
43 0.17
44 0.21
45 0.24
46 0.25
47 0.31
48 0.33
49 0.35