Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A439CUP9

Protein Details
Accession A0A439CUP9   
Localization Confidence High
Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
65-84TPKRARPDYKRIRIEKRKALBasic
NLS Segment(s)
PositionSequence
65-84TPKRARPDYKRIRIEKRKAL
96-103RRETRARR
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MEKECGANQNCKNPAVPGRKLCEAHAERRRFCRRRLDAGRKASVAAQNVLLEACGDTPAEPAKETPKRARPDYKRIRIEKRKALGLCIREEKNQERRETRARRTSRVRNAAKVLLEQHPDILDASPEALRLMRMKIEGDEDNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.51
4 0.48
5 0.51
6 0.56
7 0.56
8 0.52
9 0.54
10 0.5
11 0.52
12 0.55
13 0.57
14 0.55
15 0.64
16 0.74
17 0.68
18 0.69
19 0.7
20 0.68
21 0.71
22 0.78
23 0.78
24 0.76
25 0.79
26 0.77
27 0.67
28 0.6
29 0.52
30 0.45
31 0.36
32 0.28
33 0.21
34 0.17
35 0.16
36 0.15
37 0.11
38 0.08
39 0.06
40 0.05
41 0.04
42 0.04
43 0.04
44 0.05
45 0.07
46 0.07
47 0.07
48 0.08
49 0.16
50 0.2
51 0.24
52 0.3
53 0.37
54 0.42
55 0.47
56 0.56
57 0.55
58 0.62
59 0.69
60 0.71
61 0.72
62 0.74
63 0.79
64 0.79
65 0.8
66 0.77
67 0.7
68 0.67
69 0.59
70 0.57
71 0.51
72 0.44
73 0.4
74 0.38
75 0.36
76 0.32
77 0.36
78 0.38
79 0.43
80 0.45
81 0.47
82 0.44
83 0.49
84 0.57
85 0.61
86 0.63
87 0.63
88 0.63
89 0.65
90 0.72
91 0.76
92 0.76
93 0.78
94 0.74
95 0.7
96 0.7
97 0.66
98 0.58
99 0.5
100 0.44
101 0.38
102 0.36
103 0.3
104 0.26
105 0.22
106 0.22
107 0.2
108 0.16
109 0.11
110 0.09
111 0.1
112 0.09
113 0.09
114 0.09
115 0.09
116 0.1
117 0.11
118 0.13
119 0.15
120 0.16
121 0.17
122 0.18
123 0.23