Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A439CU36

Protein Details
Accession A0A439CU36    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
90-116ASNKSSSRKGRIEKRRKTSKIVFPKYGHydrophilic
NLS Segment(s)
PositionSequence
94-125SSSRKGRIEKRRKTSKIVFPKYGDKAKQKRKH
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRASSRKANNQRLKADVFGPVETERNARLSAKLLELATAAKREPSDSESMNIVGADSAATKNGKAETDCAAGETSMDIDTAKSTAASNKSSSRKGRIEKRRKTSKIVFPKYGDKAKQKRKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.76
4 0.68
5 0.6
6 0.5
7 0.45
8 0.38
9 0.3
10 0.27
11 0.23
12 0.22
13 0.21
14 0.21
15 0.16
16 0.16
17 0.17
18 0.15
19 0.15
20 0.17
21 0.18
22 0.18
23 0.19
24 0.17
25 0.16
26 0.15
27 0.16
28 0.13
29 0.12
30 0.11
31 0.1
32 0.1
33 0.11
34 0.12
35 0.13
36 0.15
37 0.15
38 0.16
39 0.16
40 0.16
41 0.15
42 0.13
43 0.1
44 0.07
45 0.06
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.06
53 0.07
54 0.08
55 0.08
56 0.1
57 0.11
58 0.13
59 0.13
60 0.13
61 0.12
62 0.11
63 0.1
64 0.09
65 0.07
66 0.05
67 0.05
68 0.04
69 0.04
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.1
76 0.13
77 0.15
78 0.18
79 0.26
80 0.31
81 0.38
82 0.42
83 0.46
84 0.51
85 0.58
86 0.65
87 0.69
88 0.75
89 0.78
90 0.84
91 0.87
92 0.84
93 0.84
94 0.83
95 0.83
96 0.83
97 0.81
98 0.78
99 0.72
100 0.76
101 0.74
102 0.74
103 0.71
104 0.7
105 0.72