Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A439DGX5

Protein Details
Accession A0A439DGX5    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
250-273YDHDRDRGGRRSSRRRSMEREVDPBasic
NLS Segment(s)
PositionSequence
181-212RRAGRNAVEKRIEARRARDEIKQEKWERKWRR
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, cyto 5.5, mito 3, plas 2, extr 2
Family & Domain DBs
Amino Acid Sequences MSRYEDGYPSRGRAADYYTYSAGGAAAAAPPYPHTASPGHTTYDGQPQARLTYEPQGTYYPPRSPSAGLHASESHSRPRSLARPIDSARDRTRGRSDSDDSVDGRIRSPIEKAKRFVDNTFTDSTTGIGVGVLGALVGGLAAREAVDLTSNREKQKGGHDGDDAEHKRNQLIGTVVGAAXRRAGRNAVEKRIEARRARDEIKQEKWERKWRRPDGDAEVLEKIDVVARPRSREAYSRGSRNKDDWDARDDYDHDRDRGGRRSSRRRSMEREVDPGARSWRDVEDWVLDDGDEDRRRRSRDSYRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.33
4 0.35
5 0.32
6 0.31
7 0.29
8 0.27
9 0.21
10 0.14
11 0.1
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.08
18 0.12
19 0.14
20 0.13
21 0.16
22 0.17
23 0.21
24 0.26
25 0.27
26 0.26
27 0.25
28 0.27
29 0.27
30 0.35
31 0.36
32 0.3
33 0.3
34 0.29
35 0.3
36 0.29
37 0.28
38 0.21
39 0.25
40 0.27
41 0.25
42 0.26
43 0.26
44 0.27
45 0.32
46 0.34
47 0.3
48 0.31
49 0.32
50 0.32
51 0.32
52 0.32
53 0.33
54 0.34
55 0.3
56 0.29
57 0.29
58 0.29
59 0.32
60 0.31
61 0.31
62 0.29
63 0.29
64 0.27
65 0.32
66 0.35
67 0.38
68 0.43
69 0.39
70 0.43
71 0.44
72 0.52
73 0.49
74 0.5
75 0.46
76 0.48
77 0.45
78 0.42
79 0.48
80 0.43
81 0.43
82 0.44
83 0.44
84 0.4
85 0.42
86 0.4
87 0.33
88 0.32
89 0.31
90 0.25
91 0.22
92 0.18
93 0.16
94 0.15
95 0.18
96 0.23
97 0.29
98 0.34
99 0.36
100 0.39
101 0.44
102 0.46
103 0.44
104 0.43
105 0.36
106 0.35
107 0.34
108 0.31
109 0.25
110 0.22
111 0.21
112 0.14
113 0.11
114 0.07
115 0.05
116 0.04
117 0.03
118 0.03
119 0.02
120 0.02
121 0.02
122 0.01
123 0.01
124 0.01
125 0.01
126 0.01
127 0.01
128 0.01
129 0.02
130 0.02
131 0.02
132 0.02
133 0.04
134 0.04
135 0.09
136 0.16
137 0.19
138 0.2
139 0.21
140 0.22
141 0.22
142 0.3
143 0.33
144 0.29
145 0.28
146 0.28
147 0.28
148 0.28
149 0.34
150 0.28
151 0.23
152 0.22
153 0.2
154 0.2
155 0.21
156 0.2
157 0.13
158 0.13
159 0.11
160 0.1
161 0.11
162 0.11
163 0.09
164 0.09
165 0.08
166 0.09
167 0.09
168 0.09
169 0.09
170 0.12
171 0.2
172 0.24
173 0.3
174 0.3
175 0.3
176 0.33
177 0.39
178 0.44
179 0.38
180 0.4
181 0.41
182 0.44
183 0.46
184 0.47
185 0.49
186 0.5
187 0.53
188 0.57
189 0.56
190 0.59
191 0.64
192 0.7
193 0.71
194 0.73
195 0.77
196 0.77
197 0.79
198 0.75
199 0.73
200 0.71
201 0.7
202 0.61
203 0.53
204 0.44
205 0.36
206 0.32
207 0.25
208 0.17
209 0.11
210 0.11
211 0.11
212 0.18
213 0.2
214 0.24
215 0.27
216 0.31
217 0.31
218 0.35
219 0.38
220 0.42
221 0.46
222 0.52
223 0.57
224 0.6
225 0.61
226 0.59
227 0.59
228 0.57
229 0.57
230 0.51
231 0.49
232 0.46
233 0.44
234 0.43
235 0.39
236 0.35
237 0.37
238 0.38
239 0.32
240 0.31
241 0.36
242 0.39
243 0.45
244 0.48
245 0.47
246 0.54
247 0.64
248 0.72
249 0.77
250 0.8
251 0.8
252 0.81
253 0.84
254 0.84
255 0.78
256 0.74
257 0.68
258 0.63
259 0.56
260 0.51
261 0.46
262 0.37
263 0.33
264 0.29
265 0.27
266 0.25
267 0.26
268 0.25
269 0.23
270 0.24
271 0.24
272 0.22
273 0.19
274 0.17
275 0.17
276 0.23
277 0.25
278 0.24
279 0.31
280 0.37
281 0.42
282 0.46
283 0.54