Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A439CPG4

Protein Details
Accession A0A439CPG4   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-62HLSALGIHPRRRRRRQRLCRDIHPTTIHydrophilic
205-226SSCVLRPRFRVRRRCDLTRPFEHydrophilic
NLS Segment(s)
PositionSequence
44-50PRRRRRR
Subcellular Location(s) cyto_nucl 9, nucl 8.5, cyto 8.5, mito 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTTPDITVNLTRYSLNYVVAYDKALWQPPLKWTSAHLSALGIHPRRRRRRQRLCRDIHPTTISDGVNEEDGDSSDTDNEHNHEGGGERGERGERGDEYYDAVIPDLTPARLGQFIASFSGGGLYETRASRLTGLLLRIPRPPAPVAAGHRDMNKDLERRDDGVLGRRFSFRWMTPQLVVGPRKYKLHFLFHLFLNAALVLPYVDSSCVLRPRFRVRRRCDLTRPFEPFIAAVLIGLAQSSVSLEKADSEKSQSNTKVAANHLSLNKTNESATDGVITVRTVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.19
4 0.19
5 0.2
6 0.2
7 0.21
8 0.16
9 0.18
10 0.2
11 0.23
12 0.24
13 0.24
14 0.27
15 0.33
16 0.36
17 0.33
18 0.3
19 0.3
20 0.34
21 0.37
22 0.35
23 0.28
24 0.25
25 0.25
26 0.29
27 0.34
28 0.31
29 0.33
30 0.4
31 0.5
32 0.6
33 0.69
34 0.76
35 0.8
36 0.86
37 0.91
38 0.95
39 0.96
40 0.93
41 0.92
42 0.9
43 0.82
44 0.77
45 0.68
46 0.58
47 0.49
48 0.45
49 0.35
50 0.26
51 0.23
52 0.18
53 0.16
54 0.15
55 0.12
56 0.08
57 0.08
58 0.09
59 0.09
60 0.08
61 0.08
62 0.08
63 0.08
64 0.09
65 0.11
66 0.11
67 0.11
68 0.1
69 0.1
70 0.1
71 0.11
72 0.12
73 0.11
74 0.09
75 0.1
76 0.11
77 0.11
78 0.11
79 0.13
80 0.11
81 0.13
82 0.15
83 0.14
84 0.15
85 0.16
86 0.15
87 0.12
88 0.12
89 0.08
90 0.07
91 0.08
92 0.07
93 0.06
94 0.06
95 0.06
96 0.07
97 0.08
98 0.08
99 0.07
100 0.07
101 0.08
102 0.08
103 0.08
104 0.07
105 0.06
106 0.07
107 0.06
108 0.06
109 0.05
110 0.05
111 0.08
112 0.08
113 0.09
114 0.09
115 0.09
116 0.1
117 0.09
118 0.1
119 0.1
120 0.11
121 0.13
122 0.14
123 0.15
124 0.16
125 0.18
126 0.17
127 0.18
128 0.17
129 0.15
130 0.15
131 0.17
132 0.18
133 0.21
134 0.23
135 0.22
136 0.23
137 0.24
138 0.22
139 0.23
140 0.24
141 0.22
142 0.2
143 0.23
144 0.23
145 0.24
146 0.24
147 0.23
148 0.21
149 0.27
150 0.3
151 0.26
152 0.26
153 0.25
154 0.24
155 0.24
156 0.27
157 0.19
158 0.23
159 0.25
160 0.26
161 0.25
162 0.27
163 0.28
164 0.3
165 0.31
166 0.27
167 0.28
168 0.28
169 0.31
170 0.31
171 0.36
172 0.34
173 0.39
174 0.39
175 0.41
176 0.42
177 0.39
178 0.4
179 0.32
180 0.27
181 0.2
182 0.17
183 0.1
184 0.07
185 0.07
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.05
192 0.06
193 0.1
194 0.16
195 0.18
196 0.21
197 0.27
198 0.37
199 0.48
200 0.56
201 0.62
202 0.64
203 0.73
204 0.78
205 0.82
206 0.81
207 0.81
208 0.79
209 0.78
210 0.77
211 0.68
212 0.61
213 0.53
214 0.43
215 0.34
216 0.27
217 0.18
218 0.1
219 0.08
220 0.07
221 0.06
222 0.06
223 0.04
224 0.03
225 0.03
226 0.04
227 0.04
228 0.05
229 0.06
230 0.06
231 0.09
232 0.11
233 0.14
234 0.15
235 0.2
236 0.26
237 0.28
238 0.36
239 0.36
240 0.37
241 0.37
242 0.38
243 0.37
244 0.34
245 0.38
246 0.32
247 0.36
248 0.38
249 0.39
250 0.4
251 0.39
252 0.38
253 0.33
254 0.31
255 0.26
256 0.26
257 0.22
258 0.2
259 0.17
260 0.15
261 0.15
262 0.15